PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Traes_7BL_07CC0B6EF.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
|
||||||||
Family | bZIP | ||||||||
Protein Properties | Length: 169aa MW: 18777.4 Da PI: 9.9248 | ||||||||
Description | bZIP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | bZIP_1 | 44.1 | 4.4e-14 | 64 | 116 | 3 | 55 |
XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 3 elkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkke 55 + +r rr+ +NRe+ArrsR+RK a++ Le v++L++e +L k+l e +++ Traes_7BL_07CC0B6EF.1 64 DTRRIRRMVSNRESARRSRRRKHAQLTDLELQVEQLKSESATLFKQLTEANQQ 116 56899***************************************777776665 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00338 | 2.5E-13 | 62 | 126 | IPR004827 | Basic-leucine zipper domain |
PROSITE profile | PS50217 | 10.749 | 64 | 116 | IPR004827 | Basic-leucine zipper domain |
Pfam | PF00170 | 2.3E-11 | 65 | 116 | IPR004827 | Basic-leucine zipper domain |
Gene3D | G3DSA:1.20.5.170 | 3.2E-12 | 66 | 117 | No hit | No description |
SuperFamily | SSF57959 | 5.7E-11 | 66 | 118 | No hit | No description |
PROSITE pattern | PS00036 | 0 | 69 | 84 | IPR004827 | Basic-leucine zipper domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0042803 | Molecular Function | protein homodimerization activity | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 169 aa Download sequence Send to blast |
FRVGKEIDRD TPGFCLTCCI VLVAASPRET ISGNQALETE SDSDSESLVE IGGGRCKRSG 60 KSSDTRRIRR MVSNRESARR SRRRKHAQLT DLELQVEQLK SESATLFKQL TEANQQFTTA 120 VTDNRILKSD VETLRIKVKM AEDMVARGAV SCGLGQQLGL APFLNSRKM |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcriptional activator that possesses broad binding specificity for DNA promoter elements with the core sequence 5'-ACGT-3'. May be involved in the regulation of genes expressed during seed development (PubMed:7919992). Binds to the DNA specific sequence 5'-TGAGTCA-3' found in seed storage protein gene promoters (PubMed:11133985). {ECO:0000269|PubMed:11133985, ECO:0000269|PubMed:7919992}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AK361338 | 1e-180 | AK361338.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv1138D02. | |||
GenBank | AK363257 | 1e-180 | AK363257.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2013M10. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020167700.1 | 8e-99 | basic leucine zipper 9-like isoform X1 | ||||
Refseq | XP_020167701.1 | 8e-99 | basic leucine zipper 9-like isoform X2 | ||||
Swissprot | Q6ETX0 | 1e-60 | RSBZ3_ORYSJ; bZIP transcription factor RISBZ3 | ||||
TrEMBL | A0A3B6TRJ2 | 2e-97 | A0A3B6TRJ2_WHEAT; Uncharacterized protein | ||||
TrEMBL | M7ZTE2 | 4e-98 | M7ZTE2_TRIUA; Regulatory protein opaque-2 | ||||
TrEMBL | M8AMI0 | 2e-97 | M8AMI0_AEGTA; Regulatory protein opaque-2 | ||||
STRING | Traes_7BL_07CC0B6EF.1 | 1e-119 | (Triticum aestivum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP2095 | 37 | 96 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G24800.1 | 9e-28 | basic leucine zipper 9 |
Publications ? help Back to Top | |||
---|---|---|---|
|