PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Traes_7AS_458B5662C.1

Organism

Triticum aestivum

Taxonomic ID

4565

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum

Family

MYB_related

Protein Properties

Length: 97aa MW: 10851.1 Da PI: 4.7304

Description

MYB_related family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Traes_7AS_458B5662C.1	genome	IWGSC	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	56.4	6.7e-18	39	86	1	48
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+WTt Ed llv+ v+q+G g+W+++ r g+ R++k+c++rw ++l Traes_7AS_458B5662C.1 39 KGPWTTAEDALLVNHVRQHGEGNWNAVQRITGLLRCGKSCRLRWTNHL 86 79****************************99*********996 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51294	19.983	34	90	IPR017930	Myb domain
Gene3D	G3DSA:1.10.10.60	6.9E-22	37	96	IPR009057	Homeodomain-like
SMART	SM00717	9.9E-14	38	88	IPR001005	SANT/Myb domain
Pfam	PF00249	2.9E-15	39	86	IPR001005	SANT/Myb domain
SuperFamily	SSF46689	3.59E-18	40	96	IPR009057	Homeodomain-like
CDD	cd00167	1.02E-11	41	86	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 97 aa Download sequence Send to blast
MDATSLEEEQ VAVAADNLDE EVEQMEEGEE EATPVVLKKG PWTTAEDALL VNHVRQHGEG 60 NWNAVQRITG LLRCGKSCRL RWTNHLRPNL KKGAFSP

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription activator (PubMed:24278028, PubMed:25268707). Binds to 5'-CAACTGTC-3' and/or 5'-TAACAAA-3' motif in target gene promoter (e.g. alpha-amylase) to promote their expression (PubMed:11743113). Positive regulator of abscisic acid (ABA) responses leading to growth arrest during seed germination (PubMed:17217461). Promotes the expression of aleurone-related genes (e.g. CP1, CP, GASA1, BXL1 and BXL2) in seeds. Together with MYB33 and MYB65, promotes the programmed cell death (PCD) leading to vacuolation of protein storage vacuoles (PSVs) in the aleurone layers during seed germination (PubMed:20699403). Maybe involved in the regulation of leaves lamina morphogenesis (PubMed:25268707). Involved in pollen grain development (PubMed:22101548). Together with MYB97 and MYB120, functions as a male factor that controls pollen tube-synergid interaction in fertilization. Required for pollen tube growth arrest and sperm cell release in the female gametophyte, probably via the regulation of pollen tube-specific gene expression (PubMed:24278028, PubMed:23791732). {ECO:0000269\|PubMed:11743113, ECO:0000269\|PubMed:17217461, ECO:0000269\|PubMed:20699403, ECO:0000269\|PubMed:22101548, ECO:0000269\|PubMed:23791732, ECO:0000269\|PubMed:24278028, ECO:0000269\|PubMed:25268707}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Repressed in germinating seeds by microRNA159 (miR159)-mediated cleavage in an abscisic acid (ABA) and ABI3-dependent manner, probably to desensitize hormone signaling during seedling stress responses (PubMed:15226253, PubMed:17217461). Induced by increased upon gibberellic acid (GA) treatment (PubMed:20699403). {ECO:0000269\|PubMed:15226253, ECO:0000269\|PubMed:17217461, ECO:0000269\|PubMed:20699403}.

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AC147962	7e-63	AC147962.1 Oryza sativa chromosome 3 BAC OSJNBa0083K01 genomic sequence, complete sequence.
GenBank	AP014959	7e-63	AP014959.1 Oryza sativa Japonica Group DNA, chromosome 3, cultivar: Nipponbare, complete sequence.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_020182637.1	1e-48	uncharacterized protein LOC109768314
Swissprot	O80883	3e-31	MB101_ARATH; Transcription factor MYB101
TrEMBL	A0A3B6RAC1	5e-62	A0A3B6RAC1_WHEAT; Uncharacterized protein
STRING	Traes_7AS_458B5662C.1	6e-66	(Triticum aestivum)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP7420	37	50

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT2G32460.2	1e-33	myb domain protein 101

Publications ? help Back to Top
Brenchley R, et al. Analysis of the bread wheat genome using whole-genome shotgun sequencing. Nature, 2012. 491(7426): p. 705-10 [PMID:23192148] Zheng Z, et al. Target RNA Secondary Structure Is a Major Determinant of miR159 Efficacy. Plant Physiol., 2017. 174(3): p. 1764-1778 [PMID:28515145] Xue T,Liu Z,Dai X,Xiang F Primary root growth in Arabidopsis thaliana is inhibited by the miR159 mediated repression of MYB33, MYB65 and MYB101. Plant Sci., 2017. 262: p. 182-189 [PMID:28716415]