PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT2G32460.2
Common NameATM1, ATMYB101, MYB101
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family MYB
Protein Properties Length: 478aa    MW: 53314.1 Da    PI: 5.4219
Description myb domain protein 101
Gene Model
Gene Model ID Type Source Coding Sequence
AT2G32460.2genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.51.1e-16855148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WTt Ed +l ++v+++G g+W+++ +  g+ R++k+c++rw ++l
      AT2G32460.2  8 KGPWTTTEDAILTEYVRKHGEGNWNAVQKNSGLLRCGKSCRLRWANHL 55
                     79******************************99**********9986 PP

2Myb_DNA-binding51.91.7e-1661104146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      +g++T++E+++++d++++lG++ W++ a+ ++ gRt++++k++w++
      AT2G32460.2  61 KGSFTPDEEKIIIDLHAKLGNK-WARMASQLP-GRTDNEIKNYWNT 104
                      799*******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.354355IPR017930Myb domain
SuperFamilySSF466892.85E-295102IPR009057Homeodomain-like
SMARTSM007176.4E-14757IPR001005SANT/Myb domain
PfamPF002491.0E-14855IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.0E-23962IPR009057Homeodomain-like
CDDcd001671.24E-101055No hitNo description
PROSITE profilePS5129424.97656110IPR017930Myb domain
SMARTSM007179.1E-1660108IPR001005SANT/Myb domain
PfamPF002494.3E-1561104IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.4E-2563109IPR009057Homeodomain-like
CDDcd001672.04E-1163104No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006357Biological Processregulation of transcription from RNA polymerase II promoter
GO:0009555Biological Processpollen development
GO:0009740Biological Processgibberellic acid mediated signaling pathway
GO:0009789Biological Processpositive regulation of abscisic acid-activated signaling pathway
GO:0030154Biological Processcell differentiation
GO:0043068Biological Processpositive regulation of programmed cell death
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0090406Cellular Componentpollen tube
GO:0000981Molecular FunctionRNA polymerase II transcription factor activity, sequence-specific DNA binding
GO:0001135Molecular Functiontranscription factor activity, RNA polymerase II transcription factor recruiting
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0025022anatomycollective leaf structure
PO:0025195anatomypollen tube cell
PO:0025281anatomypollen
PO:0001016developmental stageL mature pollen stage
PO:0001017developmental stageM germinated pollen stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 478 aa     Download sequence    Send to blast
MVGRGLKKGP WTTTEDAILT EYVRKHGEGN WNAVQKNSGL LRCGKSCRLR WANHLRPNLK  60
KGSFTPDEEK IIIDLHAKLG NKWARMASQL PGRTDNEIKN YWNTRMKRRQ RAGLPLYPHE  120
IQHQGIDIDD EFEFDLTSFQ FQNQDLDHNH QNMIQYTNSS NTSSSSSSFS SSSSQPSKRL  180
RPDPLVSTNP GLNPIPDSSM DFQMFSLYNN SLENDNNQFG FSVPLSSSSS SNEVCNPNHI  240
LEYISENSDT RNTNKKDIDA MSYSSLLMGD LEIRSSSFPL GLDNSVLELP SNQRPTHSFS  300
SSPIIDNGVH LEPPSGNSGL LDALLEESQA LSRGGLFKDV RVSSSDLCEV QDKRVKMDFE  360
NLLIDHLNSS NHSSLGANPN IHNKYNEPTM VKVTVDDDDE LLTSLLNNFP STTTPLPDWY  420
RVTEMQNEAS YLAPPSGILM GNHQGNGRVE PPTVPPSSSV DPMASLGSCY WSNMPSIC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-3061095107B-MYB
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.282700.0seed
Expression -- Microarray ? help Back to Top
Source ID E-value
Genevisible267087_at0.0
Expression AtlasAT2G32460-
AtGenExpressAT2G32460-
ATTED-IIAT2G32460-
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Present in a small patch of cells on the innermost side of the hypocotyl hook of the germinating seedling, in the subapical pith cells of plants growing vegetatively, in a similar zone of expanding cells both in developing inflorescence stems, and below mature flowers and elongating siliques (PubMed:11743113). Accumulates in the pollen tube nucleus during pollen tube growth through the pistil (PubMed:23791732). {ECO:0000269|PubMed:11743113, ECO:0000269|PubMed:23791732}.
UniprotTISSUE SPECIFICITY: Present mostly in flowers, siliques and floral shoot tips (PubMed:11743113, PubMed:25268707). Expression is restricted to the subapical pith cells of both vegetative and flowering plants and to the hypocotyl hook (PubMed:11743113). Expressed in pollen grains and pollen tube (PubMed:23791732, PubMed:24278028). Mostly expressed in mature pollen grains, and, to a lower extent, in inflorescences and siliques (PubMed:24278028). {ECO:0000269|PubMed:11743113, ECO:0000269|PubMed:23791732, ECO:0000269|PubMed:24278028, ECO:0000269|PubMed:25268707}.
Functional Description ? help Back to Top
Source Description
TAIRMember of the R2R3 factor gene family.
UniProtTranscription activator (PubMed:24278028, PubMed:25268707). Binds to 5'-CAACTGTC-3' and/or 5'-TAACAAA-3' motif in target gene promoter (e.g. alpha-amylase) to promote their expression (PubMed:11743113). Positive regulator of abscisic acid (ABA) responses leading to growth arrest during seed germination (PubMed:17217461). Promotes the expression of aleurone-related genes (e.g. CP1, CP, GASA1, BXL1 and BXL2) in seeds. Together with MYB33 and MYB65, promotes the programmed cell death (PCD) leading to vacuolation of protein storage vacuoles (PSVs) in the aleurone layers during seed germination (PubMed:20699403). Maybe involved in the regulation of leaves lamina morphogenesis (PubMed:25268707). Involved in pollen grain development (PubMed:22101548). Together with MYB97 and MYB120, functions as a male factor that controls pollen tube-synergid interaction in fertilization. Required for pollen tube growth arrest and sperm cell release in the female gametophyte, probably via the regulation of pollen tube-specific gene expression (PubMed:24278028, PubMed:23791732). {ECO:0000269|PubMed:11743113, ECO:0000269|PubMed:17217461, ECO:0000269|PubMed:20699403, ECO:0000269|PubMed:22101548, ECO:0000269|PubMed:23791732, ECO:0000269|PubMed:24278028, ECO:0000269|PubMed:25268707}.
Function -- GeneRIF ? help Back to Top
  1. All these results indicate that MYB97, MYB101 and MYB120 participate in pollen tube reception, possibly by controlling the expression of downstream genes.
    [PMID: 24278028]
  2. enhanced expressions of two transcription factors, bHLH30 and MYB101, are able to alter leaf lamina development.
    [PMID: 25268707]
  3. Primary root growth in Arabidopsis thaliana is inhibited by the miR159 mediated repression of MYB33, MYB65 and MYB101
    [PMID: 28716415]
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00287DAP27203113Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT2G32460.2
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Repressed in germinating seeds by microRNA159 (miR159)-mediated cleavage in an abscisic acid (ABA) and ABI3-dependent manner, probably to desensitize hormone signaling during seedling stress responses (PubMed:15226253, PubMed:17217461). Induced by increased upon gibberellic acid (GA) treatment (PubMed:20699403). {ECO:0000269|PubMed:15226253, ECO:0000269|PubMed:17217461, ECO:0000269|PubMed:20699403}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Regulation -- Hormone ? help Back to Top
Source Hormone
AHDabscisic acid, gibberellin
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT2G32460
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2293420.0AK229342.1 Arabidopsis thaliana mRNA for putative MYB family transcription factor, complete cds, clone: RAFL16-59-F24.
GenBankAY5195760.0AY519576.1 Arabidopsis thaliana MYB transcription factor (At2g32460) mRNA, complete cds.
GenBankBT0263810.0BT026381.1 Arabidopsis thaliana At2g32460 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001077993.10.0myb domain protein 101
SwissprotO808830.0MB101_ARATH; Transcription factor MYB101
TrEMBLA0A178VTW30.0A0A178VTW3_ARATH; MYB101
STRINGAT2G32460.10.0(Arabidopsis thaliana)
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Stracke R,Werber M,Weisshaar B
    The R2R3-MYB gene family in Arabidopsis thaliana.
    Curr. Opin. Plant Biol., 2001. 4(5): p. 447-56
    [PMID:11597504]
  3. Gocal GF, et al.
    GAMYB-like genes, flowering, and gibberellin signaling in Arabidopsis.
    Plant Physiol., 2001. 127(4): p. 1682-93
    [PMID:11743113]
  4. Reyes JL,Chua NH
    ABA induction of miR159 controls transcript levels of two MYB factors during Arabidopsis seed germination.
    Plant J., 2007. 49(4): p. 592-606
    [PMID:17217461]
  5. Wang Y, et al.
    Transcriptome analyses show changes in gene expression to accompany pollen germination and tube growth in Arabidopsis.
    Plant Physiol., 2008. 148(3): p. 1201-11
    [PMID:18775970]
  6. Kim S, et al.
    Two cap-binding proteins CBP20 and CBP80 are involved in processing primary MicroRNAs.
    Plant Cell Physiol., 2008. 49(11): p. 1634-44
    [PMID:18829588]
  7. Jiang W,Yu D
    Arabidopsis WRKY2 transcription factor mediates seed germination and postgermination arrest of development by abscisic acid.
    BMC Plant Biol., 2009. 9: p. 96
    [PMID:19622176]
  8. Alonso-Peral MM, et al.
    The microRNA159-regulated GAMYB-like genes inhibit growth and promote programmed cell death in Arabidopsis.
    Plant Physiol., 2010. 154(2): p. 757-71
    [PMID:20699403]
  9. Reňák D,Dupl'áková N,Honys D
    Wide-scale screening of T-DNA lines for transcription factor genes affecting male gametophyte development in Arabidopsis.
    Sex. Plant Reprod., 2012. 25(1): p. 39-60
    [PMID:22101548]
  10. Daszkowska-Golec A, et al.
    Arabidopsis suppressor mutant of abh1 shows a new face of the already known players: ABH1 (CBP80) and ABI4-in response to ABA and abiotic stresses during seed germination.
    Plant Mol. Biol., 2013. 81(1-2): p. 189-209
    [PMID:23196831]
  11. Efroni I, et al.
    Regulation of leaf maturation by chromatin-mediated modulation of cytokinin responses.
    Dev. Cell, 2013. 24(4): p. 438-45
    [PMID:23449474]
  12. Leydon AR, et al.
    Three MYB transcription factors control pollen tube differentiation required for sperm release.
    Curr. Biol., 2013. 23(13): p. 1209-14
    [PMID:23791732]
  13. Liang Y, et al.
    MYB97, MYB101 and MYB120 function as male factors that control pollen tube-synergid interaction in Arabidopsis thaliana fertilization.
    PLoS Genet., 2013. 9(11): p. e1003933
    [PMID:24278028]
  14. An R, et al.
    The over-expression of two transcription factors, ABS5/bHLH30 and ABS7/MYB101, leads to upwardly curly leaves.
    PLoS ONE, 2014. 9(9): p. e107637
    [PMID:25268707]
  15. Zheng Z, et al.
    Target RNA Secondary Structure Is a Major Determinant of miR159 Efficacy.
    Plant Physiol., 2017. 174(3): p. 1764-1778
    [PMID:28515145]
  16. Xue T,Liu Z,Dai X,Xiang F
    Primary root growth in Arabidopsis thaliana is inhibited by the miR159 mediated repression of MYB33, MYB65 and MYB101.
    Plant Sci., 2017. 262: p. 182-189
    [PMID:28716415]
  17. Quaedvlieg N, et al.
    Identification of a light-regulated MYB gene from an Arabidopsis transcription factor gene collection.
    Plant Mol. Biol., 1996. 32(5): p. 987-93
    [PMID:8980549]