PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Traes_7AL_20FA90AE5.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 96aa MW: 11629.3 Da PI: 10.7304 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 31.9 | 3.7e-10 | 60 | 96 | 31 | 67 |
NAM 31 eevikevdiykvePwdLpkkvkaeekewyfFskrdkk 67 + +i++v+++k+ePw+Lp+k++ +ekewyf+s++d+k Traes_7AL_20FA90AE5.1 60 TAAIEDVNLNKYEPWELPEKAEMGEKEWYFYSRKDRK 96 357***************99999***********986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51005 | 10.774 | 32 | 96 | IPR003441 | NAC domain |
SuperFamily | SSF101941 | 2.75E-9 | 60 | 96 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 96 aa Download sequence Send to blast |
LRPIFPSSQN PLHRKSLSWK TTCKFRTNSW CYHRGLGSTR RKRRSSNSMW SPRCKIIFVT 60 AAIEDVNLNK YEPWELPEKA EMGEKEWYFY SRKDRK |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
STRING | Traes_7AL_20FA90AE5.1 | 8e-66 | (Triticum aestivum) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G15170.1 | 1e-14 | NAC family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|