PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

AT3G15170.1

Common Name

ANAC054, ATNAC1, CUC1, F4B12.8, NAC054

Organism

Arabidopsis thaliana

Taxonomic ID

3702

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis

Family

NAC

Protein Properties

Length: 310aa MW: 34232.8 Da PI: 8.2019

Description

NAC family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
AT3G15170.1	genome	TAIR	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NAM	175.3	1.7e-54	20	147	1	128
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk.kg 97 +ppGfrFhPtdeel+++yL kkv ++++++ +i++vd++k+ePw+Lp+k+k +ekewyfF+ rd+ky+tg r+nrat++gyWkatgkd+e++s+ ++ AT3G15170.1 20 MPPGFRFHPTDEELITYYLLKKVLDSNFSC-AAISQVDLNKSEPWELPEKAKMGEKEWYFFTLRDRKYPTGLRTNRATEAGYWKATGKDREIKSSkTK 116 79**************************.88***********99999************************************98566 PP NAM 98 elvglkktLvfykgrapkgektdWvmheyrl 128 +l g+kktLvfykgrapkgek+ Wvmheyrl AT3G15170.1 117 SLLGMKKTLVFYKGRAPKGEKSCWVMHEYRL 147 77*************************98 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SuperFamily	SSF101941	5.49E-62	17	172	IPR003441	NAC domain
PROSITE profile	PS51005	58.63	20	172	IPR003441	NAC domain
Pfam	PF02365	1.2E-28	21	147	IPR003441	NAC domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0009793	Biological Process	embryo development ending in seed dormancy
GO:0010014	Biological Process	meristem initiation
GO:0010072	Biological Process	primary shoot apical meristem specification
GO:0010160	Biological Process	formation of organ boundary
GO:0010223	Biological Process	secondary shoot formation
GO:0048467	Biological Process	gynoecium development
GO:0048527	Biological Process	lateral root development
GO:0051782	Biological Process	negative regulation of cell division
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding

Plant Ontology ? help Back to Top
PO Term	PO Category	PO Description
PO:0000003	anatomy	whole plant
PO:0000037	anatomy	shoot apex
PO:0009009	anatomy	plant embryo
PO:0009010	anatomy	seed
PO:0009046	anatomy	flower
PO:0025022	anatomy	collective leaf structure
PO:0001078	developmental stage	plant embryo cotyledonary stage
PO:0001081	developmental stage	mature plant embryo stage
PO:0004507	developmental stage	plant embryo bilateral stage
PO:0007611	developmental stage	petal differentiation and expansion stage

Sequence ? help Back to Top
Protein Sequence Length: 310 aa Download sequence Send to blast
MDVDVFNGWG RPRFEDESLM PPGFRFHPTD EELITYYLLK KVLDSNFSCA AISQVDLNKS 60 EPWELPEKAK MGEKEWYFFT LRDRKYPTGL RTNRATEAGY WKATGKDREI KSSKTKSLLG 120 MKKTLVFYKG RAPKGEKSCW VMHEYRLDGK FSYHYISSSA KDEWVLCKVC LKSGVVSRET 180 NLISSSSSSA VTGEFSSAGS AIAPIINTFA TEHVSCFSNN SAAHTDASFH TFLPAPPPSL 240 PPRQPRHVGD GVAFGQFLDL GSSGQIDFDA AAAAFFPNLP SLPPTVLPPP PSFAMYGGGS 300 PAVSVWPFTL

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1ut4_A	3e-50	20	173	17	166	NO APICAL MERISTEM PROTEIN
1ut4_B	3e-50	20	173	17	166	NO APICAL MERISTEM PROTEIN
1ut7_A	3e-50	20	173	17	166	NO APICAL MERISTEM PROTEIN
1ut7_B	3e-50	20	173	17	166	NO APICAL MERISTEM PROTEIN
3swm_A	4e-50	20	173	20	169	NAC domain-containing protein 19
3swm_B	4e-50	20	173	20	169	NAC domain-containing protein 19
3swm_C	4e-50	20	173	20	169	NAC domain-containing protein 19
3swm_D	4e-50	20	173	20	169	NAC domain-containing protein 19
3swp_A	4e-50	20	173	20	169	NAC domain-containing protein 19
3swp_B	4e-50	20	173	20	169	NAC domain-containing protein 19
3swp_C	4e-50	20	173	20	169	NAC domain-containing protein 19
3swp_D	4e-50	20	173	20	169	NAC domain-containing protein 19
4dul_A	3e-50	20	173	17	166	NAC domain-containing protein 19
4dul_B	3e-50	20	173	17	166	NAC domain-containing protein 19
Search in ModeBase

Expression -- Microarray ? help Back to Top
Source	ID	E-value
GEO	145338530	0.0
Genevisible	256857_at	0.0
Expression Atlas	AT3G15170	-
AtGenExpress	AT3G15170	-
ATTED-II	AT3G15170	-

Expression -- Description ? help Back to Top
Source	Description
Uniprot	DEVELOPMENTAL STAGE: First observed in young embryonic SAM. Later confined to the boundaries between cotyledon primordia and the SAM. In mature embryos, localized around first leaves primordia. Only weakly present in vegetative SAM. In inflorescence, observed at the boundaries between floral organ primordia. In callus, expressed during transition to shoot development, with a progressive restriction to specific areas corresponding to future shoot apex. {ECO:0000269\|PubMed:11245578, ECO:0000269\|PubMed:12492830}.
Uniprot	TISSUE SPECIFICITY: Expressed in inflorescence stems, rosette leaves, aerial parts of seedlings, flowers, floral buds and roots. {ECO:0000269\|PubMed:11245578}.

Functional Description ? help Back to Top
Source	Description
TAIR	Encodes a transcription factor involved in shoot apical meristem formation and auxin-mediated lateral root formation. The gene is thought not to be involved in stress responses (NaCl, auxins, ethylene). Cuc mutant was first recognized at the heart stage, where embryos lacking two distinct bulges of cotyledonary primordia were observed.
UniProt	Transcription activator of STM and KNAT6. Involved in molecular mechanisms regulating shoot apical meristem (SAM) formation during embryogenesis and organ separation. Required for the fusion of septa of gynoecia along the length of the ovaries. Activates the shoot formation in callus in a STM-dependent manner. Seems to act as an inhibitor of cell division. {ECO:0000269\|PubMed:10079219, ECO:0000269\|PubMed:10750709, ECO:0000269\|PubMed:11245578, ECO:0000269\|PubMed:12163400, ECO:0000269\|PubMed:12492830, ECO:0000269\|PubMed:12610213, ECO:0000269\|PubMed:12787253, ECO:0000269\|PubMed:14617069, ECO:0000269\|PubMed:15202996, ECO:0000269\|PubMed:15294871, ECO:0000269\|PubMed:15500463, ECO:0000269\|PubMed:15723790, ECO:0000269\|PubMed:16798887, ECO:0000269\|PubMed:17122068, ECO:0000269\|PubMed:17287247, ECO:0000269\|PubMed:9212461}.

Function -- GeneRIF ? help Back to Top
The molecular basis for the activity of the protein. [PMID: 15500463] These results suggest that ESR2 plays a role in shoot regeneration through transcriptional regulation of CUC1. [PMID: 17056621] Regulation of axillary meristem formation by miR164 is mediated through CUC1 and CUC2, which in turn regulate LAS. [PMID: 18346190] CUC1 and CUC2 resulted from duplications of a unique ancestral gene and show different patterns of evolution. [PMID: 21258003] CUC1 directly activates transcription of the nuclear factor genes LSH4 and LSH3, which may suppress organ differentiation in the boundary region. [PMID: 21435050] The results bring new insights into the mechanistic links between KNOXI and CUC transcription factors and contribute to the understanding of the regulatory network controlled by STM. [PMID: 21685178] suppresses growth of sepal tissues from the boundary region [PMID: 22507233] SPT negatively regulates CUC1 and CUC2 expression in the apical part of the gynoecium. [PMID: 22514090] CUC1, CUC2, and AINTEGUMENTA have additive effects on ovule primordia formation. [PMID: 23941199] cuc1 grf1/2/3, cuc2 grf1/2/3, and cuc3 grf1/2/3 quadruple mutants showed dramatic increases in cotyledon fusion as well as floral organ fusion. [PMID: 25761011]

Binding Motif ? help Back to Top
Motif ID	Method	Source	Motif file
MP00357	DAP	27203113	Download

Cis-element ? help Back to Top
Source	Link
PlantRegMap	AT3G15170.1

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: By BRM, at the chromatin level, and conferring a very specific spatial expression pattern. Directly induced by ESR2 in response to cytokinins. Precise spatial regulation by post-transcriptional repression directed by the microRNA miR164. {ECO:0000269\|PubMed:15202996, ECO:0000269\|PubMed:15294871, ECO:0000269\|PubMed:15723790, ECO:0000269\|PubMed:16854978, ECO:0000269\|PubMed:17056621, ECO:0000269\|PubMed:17287247}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	Retrieve

Regulation -- ATRM (Manually Curated Upstream Regulators) ? help Back to Top
Source	Upstream Regulator (A: Activate/R: Repress)
ATRM	AT1G24590 (A), AT1G65620 (R), AT2G37630 (R), AT4G32980 (A)

Regulation -- ATRM (Manually Curated Target Genes) ? help Back to Top
Source	Target Gene (A: Activate/R: Repress)
ATRM	AT1G23380(A), AT1G55580(A), AT1G62360(A), AT1G76420(A), AT2G31160(A), AT3G23290(A)

Regulation -- Hormone ? help Back to Top
Source	Hormone
AHD	auxin, ethylene

Interaction ? help Back to Top
Source	Intact With
BioGRID	AT3G15170

Phenotype -- Mutation ? help Back to Top
Source	ID
T-DNA Express	AT3G15170

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AB049069	0.0	AB049069.1 Arabidopsis thaliana CUC1 mRNA, complete cds.
GenBank	BT026080	0.0	BT026080.1 Arabidopsis thaliana At3g15170 mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	NP_188135.1	0.0	NAC (No Apical Meristem) domain transcriptional regulator superfamily protein
Swissprot	Q9FRV4	0.0	NAC54_ARATH; Protein CUP-SHAPED COTYLEDON 1
TrEMBL	A0A178V703	0.0	A0A178V703_ARATH; CUC1
STRING	AT3G15170.1	0.0	(Arabidopsis thaliana)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM13481	15	28
Representative plant	OGRP17	15	800

Link Out ? help Back to Top
Phytozome	AT3G15170.1
Entrez Gene	820748
iHOP	AT3G15170
wikigenes	AT3G15170

Publications ? help Back to Top
Aida M,Ishida T,Tasaka M Shoot apical meristem and cotyledon formation during Arabidopsis embryogenesis: interaction among the CUP-SHAPED COTYLEDON and SHOOT MERISTEMLESS genes. Development, 1999. 126(8): p. 1563-70 [PMID:10079219] Ishida T,Aida M,Takada S,Tasaka M Involvement of CUP-SHAPED COTYLEDON genes in gynoecium and ovule development in Arabidopsis thaliana. Plant Cell Physiol., 2000. 41(1): p. 60-7 [PMID:10750709] Riechmann JL, et al. Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes. Science, 2000. 290(5499): p. 2105-10 [PMID:11118137] Takada S,Hibara K,Ishida T,Tasaka M The CUP-SHAPED COTYLEDON1 gene of Arabidopsis regulates shoot apical meristem formation. Development, 2001. 128(7): p. 1127-35 [PMID:11245578] Sharma VK,Fletcher JC Maintenance of shoot and floral meristem cell proliferation and fate. Plant Physiol., 2002. 129(1): p. 31-9 [PMID:12011335] Aida M,Vernoux T,Furutani M,Traas J,Tasaka M Roles of PIN-FORMED1 and MONOPTEROS in pattern formation of the apical region of the Arabidopsis embryo. Development, 2002. 129(17): p. 3965-74 [PMID:12163400] Cary AJ,Che P,Howell SH Developmental events and shoot apical meristem gene expression patterns during shoot development in Arabidopsis thaliana. Plant J., 2002. 32(6): p. 867-77 [PMID:12492830] Daimon Y,Takabe K,Tasaka M The CUP-SHAPED COTYLEDON genes promote adventitious shoot formation on calli. Plant Cell Physiol., 2003. 44(2): p. 113-21 [PMID:12610213] Hiratsu K,Matsui K,Koyama T,Ohme-Takagi M Dominant repression of target genes by chimeric repressors that include the EAR motif, a repression domain, in Arabidopsis. Plant J., 2003. 34(5): p. 733-9 [PMID:12787253] Vroemen CW,Mordhorst AP,Albrecht C,Kwaaitaal MA,de Vries SC The CUP-SHAPED COTYLEDON3 gene is required for boundary and shoot meristem formation in Arabidopsis. Plant Cell, 2003. 15(7): p. 1563-77 [PMID:12837947] Hibara K,Takada S,Tasaka M CUC1 gene activates the expression of SAM-related genes to induce adventitious shoot formation. Plant J., 2003. 36(5): p. 687-96 [PMID:14617069] Ooka H, et al. Comprehensive analysis of NAC family genes in Oryza sativa and Arabidopsis thaliana. DNA Res., 2003. 10(6): p. 239-47 [PMID:15029955] Mallory AC,Dugas DV,Bartel DP,Bartel B MicroRNA regulation of NAC-domain targets is required for proper formation and separation of adjacent embryonic, vegetative, and floral organs. Curr. Biol., 2004. 14(12): p. 1035-46 [PMID:15202996] Brewer PB, et al. PETAL LOSS, a trihelix transcription factor gene, regulates perianth architecture in the Arabidopsis flower. Development, 2004. 131(16): p. 4035-45 [PMID:15269176] Laufs P,Peaucelle A,Morin H,Traas J MicroRNA regulation of the CUC genes is required for boundary size control in Arabidopsis meristems. Development, 2004. 131(17): p. 4311-22 [PMID:15294871] Furutani M, et al. PIN-FORMED1 and PINOID regulate boundary formation and cotyledon development in Arabidopsis embryogenesis. Development, 2004. 131(20): p. 5021-30 [PMID:15371311] Taoka K, et al. The NAC domain mediates functional specificity of CUP-SHAPED COTYLEDON proteins. Plant J., 2004. 40(4): p. 462-73 [PMID:15500463] Kajiwara T,Furutani M,Hibara K,Tasaka M The GURKE gene encoding an acetyl-CoA carboxylase is required for partitioning the embryo apex into three subregions in Arabidopsis. Plant Cell Physiol., 2004. 45(9): p. 1122-8 [PMID:15509834] Baker CC,Sieber P,Wellmer F,Meyerowitz EM The early extra petals1 mutant uncovers a role for microRNA miR164c in regulating petal number in Arabidopsis. Curr. Biol., 2005. 15(4): p. 303-15 [PMID:15723790] Kidner CA,Martienssen RA The role of ARGONAUTE1 (AGO1) in meristem formation and identity. Dev. Biol., 2005. 280(2): p. 504-17 [PMID:15882589] Yanai O, et al. Arabidopsis KNOXI proteins activate cytokinin biosynthesis. Curr. Biol., 2005. 15(17): p. 1566-71 [PMID:16139212] Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] He XJ, et al. AtNAC2, a transcription factor downstream of ethylene and auxin signaling pathways, is involved in salt stress response and lateral root development. Plant J., 2005. 44(6): p. 903-16 [PMID:16359384] Belles-Boix E, et al. KNAT6: an Arabidopsis homeobox gene involved in meristem activity and organ separation. Plant Cell, 2006. 18(8): p. 1900-7 [PMID:16798887] Kwon CS, et al. A role for chromatin remodeling in regulation of CUC gene expression in the Arabidopsis cotyledon boundary. Development, 2006. 133(16): p. 3223-30 [PMID:16854978] Ikeda Y,Banno H,Niu QW,Howell SH,Chua NH The ENHANCER OF SHOOT REGENERATION 2 gene in Arabidopsis regulates CUP-SHAPED COTYLEDON 1 at the transcriptional level and controls cotyledon development. Plant Cell Physiol., 2006. 47(11): p. 1443-56 [PMID:17056621] Nikovics K, et al. The balance between the MIR164A and CUC2 genes controls leaf margin serration in Arabidopsis. Plant Cell, 2006. 18(11): p. 2929-45 [PMID:17098808] Hibara K, et al. Arabidopsis CUP-SHAPED COTYLEDON3 regulates postembryonic shoot meristem and organ boundary formation. Plant Cell, 2006. 18(11): p. 2946-57 [PMID:17122068] Sieber P,Wellmer F,Gheyselinck J,Riechmann JL,Meyerowitz EM Redundancy and specialization among plant microRNAs: role of the MIR164 family in developmental robustness. Development, 2007. 134(6): p. 1051-60 [PMID:17287247] Koyama T,Furutani M,Tasaka M,Ohme-Takagi M TCP transcription factors control the morphology of shoot lateral organs via negative regulation of the expression of boundary-specific genes in Arabidopsis. Plant Cell, 2007. 19(2): p. 473-84 [PMID:17307931] Xu B, et al. Arabidopsis genes AS1, AS2, and JAG negatively regulate boundary-specifying genes to promote sepal and petal development. Plant Physiol., 2008. 146(2): p. 566-75 [PMID:18156293] Raman S, et al. Interplay of miR164, CUP-SHAPED COTYLEDON genes and LATERAL SUPPRESSOR controls axillary meristem formation in Arabidopsis thaliana. Plant J., 2008. 55(1): p. 65-76 [PMID:18346190] Skirycz A, et al. The DOF transcription factor OBP1 is involved in cell cycle regulation in Arabidopsis thaliana. Plant J., 2008. 56(5): p. 779-92 [PMID:18665917] Gómez-Mena C,Sablowski R ARABIDOPSIS THALIANA HOMEOBOX GENE1 establishes the basal boundaries of shoot organs and controls stem growth. Plant Cell, 2008. 20(8): p. 2059-72 [PMID:18757555] Atta R, et al. Pluripotency of Arabidopsis xylem pericycle underlies shoot regeneration from root and hypocotyl explants grown in vitro. Plant J., 2009. 57(4): p. 626-44 [PMID:18980654] Tamaki H, et al. Identification of novel meristem factors involved in shoot regeneration through the analysis of temperature-sensitive mutants of Arabidopsis. Plant J., 2009. 57(6): p. 1027-39 [PMID:19054368] Koizumi A,Yamanaka K,Kawano S Carpel development in a floral mutant of dioecious Silene latifolia producing asexual and female-like flowers. J. Plant Physiol., 2009. 166(16): p. 1832-8 [PMID:19457581] Mon Sex determination in plants. Plant Signal Behav, 2007. 2(3): p. 178-9 [PMID:19704689] Bazzini AA, et al. Virus infection elevates transcriptional activity of miR164a promoter in plants. BMC Plant Biol., 2009. 9: p. 152 [PMID:20042107] Koizumi A, et al. Two separate pathways including SlCLV1, SlSTM and SlCUC that control carpel development in a bisexual mutant of Silene latifolia. Plant Cell Physiol., 2010. 51(2): p. 282-93 [PMID:20064843] De Smet I,Lau S,Mayer U,J Embryogenesis - the humble beginnings of plant life. Plant J., 2010. 61(6): p. 959-70 [PMID:20409270] Hasson A, et al. Evolution and diverse roles of the CUP-SHAPED COTYLEDON genes in Arabidopsis leaf development. Plant Cell, 2011. 23(1): p. 54-68 [PMID:21258003] Takeda S, et al. CUP-SHAPED COTYLEDON1 transcription factor activates the expression of LSH4 and LSH3, two members of the ALOG gene family, in shoot organ boundary cells. Plant J., 2011. 66(6): p. 1066-77 [PMID:21435050] Spinelli SV,Martin AP,Viola IL,Gonzalez DH,Palatnik JF A mechanistic link between STM and CUC1 during Arabidopsis development. Plant Physiol., 2011. 156(4): p. 1894-904 [PMID:21685178] Uberti-Manassero NG,Lucero LE,Viola IL,Vegetti AC,Gonzalez DH The class I protein AtTCP15 modulates plant development through a pathway that overlaps with the one affected by CIN-like TCP proteins. J. Exp. Bot., 2012. 63(2): p. 809-23 [PMID:22016421] Lampugnani ER,Kilinc A,Smyth DR PETAL LOSS is a boundary gene that inhibits growth between developing sepals in Arabidopsis thaliana. Plant J., 2012. 71(5): p. 724-35 [PMID:22507233] Nahar MA,Ishida T,Smyth DR,Tasaka M,Aida M Interactions of CUP-SHAPED COTYLEDON and SPATULA genes control carpel margin development in Arabidopsis thaliana. Plant Cell Physiol., 2012. 53(6): p. 1134-43 [PMID:22514090] Huang T,L RBE controls microRNA164 expression to effect floral organogenesis. Development, 2012. 139(12): p. 2161-9 [PMID:22573623] Larsson E,Sundstr Expression of PaNAC01, a Picea abies CUP-SHAPED COTYLEDON orthologue, is regulated by polar auxin transport and associated with differentiation of the shoot apical meristem and formation of separated cotyledons. Ann. Bot., 2012. 110(4): p. 923-34 [PMID:22778149] Lie C,Kelsom C,Wu X WOX2 and STIMPY-LIKE/WOX8 promote cotyledon boundary formation in Arabidopsis. Plant J., 2012. 72(4): p. 674-82 [PMID:22827849] Qiao M,Xiang F A set of Arabidopsis thaliana miRNAs involve shoot regeneration in vitro. Plant Signal Behav, 2013. 8(3): p. e23479 [PMID:23333958] Viola IL,G Redox modulation of plant developmental regulators from the class I TCP transcription factor family. Plant Physiol., 2013. 162(3): p. 1434-47 [PMID:23686421] Pei H, et al. An NAC transcription factor controls ethylene-regulated cell expansion in flower petals. Plant Physiol., 2013. 163(2): p. 775-91 [PMID:23933991] Galbiati F, et al. An integrative model of the control of ovule primordia formation. Plant J., 2013. 76(3): p. 446-55 [PMID:23941199] Zhu Q, et al. In silico analysis on structure and DNA binding mode of AtNAC1, a NAC transcription factor from Arabidopsis thaliana. J Mol Model, 2014. 20(3): p. 2117 [PMID:24570356] Shinohara N,Ohbayashi I,Sugiyama M Involvement of rRNA biosynthesis in the regulation of CUC1 gene expression and pre-meristematic cell mound formation during shoot regeneration. Front Plant Sci, 2014. 5: p. 159 [PMID:24808900] Kamiuchi Y,Yamamoto K,Furutani M,Tasaka M,Aida M The CUC1 and CUC2 genes promote carpel margin meristem formation during Arabidopsis gynoecium development. Front Plant Sci, 2014. 5: p. 165 [PMID:24817871] Jin J, et al. An Arabidopsis Transcriptional Regulatory Map Reveals Distinct Functional and Evolutionary Features of Novel Transcription Factors. Mol. Biol. Evol., 2015. 32(7): p. 1767-73 [PMID:25750178] Lee BH,Jeon JO,Lee MM,Kim JH Genetic interaction between GROWTH-REGULATING FACTOR and CUP-SHAPED COTYLEDON in organ separation. Plant Signal Behav, 2015. 10(2): p. e988071 [PMID:25761011] Gonçalves B, et al. A conserved role for CUP-SHAPED COTYLEDON genes during ovule development. Plant J., 2015. 83(4): p. 732-42 [PMID:26119568] Cui X, et al. REF6 recognizes a specific DNA sequence to demethylate H3K27me3 and regulate organ boundary formation in Arabidopsis. Nat. Genet., 2016. 48(6): p. 694-9 [PMID:27111035] Balkunde R,Kitagawa M,Xu XM,Wang J,Jackson D SHOOT MERISTEMLESS trafficking controls axillary meristem formation, meristem size and organ boundaries in Arabidopsis. Plant J., 2017. 90(3): p. 435-446 [PMID:28161901] Koyama T,Sato F,Ohme-Takagi M Roles of miR319 and TCP Transcription Factors in Leaf Development. Plant Physiol., 2017. 175(2): p. 874-885 [PMID:28842549] González-Carranza ZH, et al. HAWAIIAN SKIRT controls size and floral organ number by modulating CUC1 and CUC2 expression. PLoS ONE, 2017. 12(9): p. e0185106 [PMID:28934292] Aida M,Ishida T,Fukaki H,Fujisawa H,Tasaka M Genes involved in organ separation in Arabidopsis: an analysis of the cup-shaped cotyledon mutant. Plant Cell, 1997. 9(6): p. 841-57 [PMID:9212461]