![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
Previous version:
v3.0
v4.0
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Traes_6BL_CE61B9510.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 197aa MW: 21924.9 Da PI: 10.529 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 49.9 | 7.5e-16 | 68 | 115 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g W++eEd++l d++ ++G g+W++ +++ g+ R +k+c++rw +yl Traes_6BL_CE61B9510.1 68 KGLWSPEEDQKLRDYILRHGHGCWSALPAKAGLQRNGKSCRLRWINYL 115 678*******************************************97 PP | |||||||
2 | Myb_DNA-binding | 54.7 | 2.4e-17 | 122 | 166 | 2 | 48 |
SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 g +++eE+e +++ lG++ W++Iar+++ gRt++++k++w++yl Traes_6BL_CE61B9510.1 122 GMFSPEEEETVMSLHAALGNK-WSRIARHLP-GRTDNEVKNYWNSYL 166 569******************.*********.*************97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 15.819 | 63 | 115 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 3.99E-29 | 65 | 162 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 5.3E-11 | 67 | 117 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 5.5E-14 | 68 | 115 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 5.9E-22 | 69 | 121 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 6.50E-10 | 71 | 115 | No hit | No description |
PROSITE profile | PS51294 | 25.123 | 116 | 170 | IPR017930 | Myb domain |
SMART | SM00717 | 6.3E-14 | 120 | 168 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 9.1E-16 | 122 | 166 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 6.1E-26 | 122 | 169 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 2.15E-11 | 124 | 166 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 197 aa Download sequence Send to blast |
MAIKLPPTAP LWKRQNAPPS QPRLEPEASA TAAASCTPLR GFVPRRSSAC KQAMGCKACD 60 KPRPSYRKGL WSPEEDQKLR DYILRHGHGC WSALPAKAGL QRNGKSCRLR WINYLRPGLK 120 HGMFSPEEEE TVMSLHAALG NKWSRIARHL PGRTDNEVKN YWNSYLKKRV EGGKEAPNSP 180 NRHAASSAAE SDGSQSQ |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1a5j_A | 1e-26 | 64 | 171 | 3 | 109 | B-MYB |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor that promotes photomorphogenesis in the light by participating in the transmission of phytochrome A (phyA) signals to downstream responses (PubMed:11581165, PubMed:19482971). Probably acts by activating expression of light-induced genes. In darkness, its degradation prevents the activation of light-induced genes (PubMed:11581165). {ECO:0000269|PubMed:11581165, ECO:0000269|PubMed:19482971}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By hormones or elicitors treatment. By exposure to abiotic stress. {ECO:0000269|PubMed:9839469}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | BT038744 | 1e-147 | BT038744.1 Zea mays full-length cDNA clone ZM_BFb0323B03 mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020168350.1 | 4e-90 | transcription factor LAF1-like | ||||
Swissprot | Q9M0K4 | 1e-55 | LAF1_ARATH; Transcription factor LAF1 | ||||
TrEMBL | A0A3B6PN21 | 1e-101 | A0A3B6PN21_WHEAT; Uncharacterized protein | ||||
TrEMBL | A0A446WG12 | 1e-102 | A0A446WG12_TRITD; Uncharacterized protein | ||||
STRING | Traes_6BL_CE61B9510.1 | 1e-143 | (Triticum aestivum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP1707 | 37 | 109 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G52260.1 | 3e-58 | myb domain protein 19 |
Publications ? help Back to Top | |||
---|---|---|---|
|