PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Home  TFext  BLAST  Prediction  Download  Help  About  Links  PlantRegMap
(e.g., LFY)
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_6BL_931C25F08.1
Organism
Triticum aestivum
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family MYB_related
Protein Properties Length: 83aa    MW: 9538.96 Da    PI: 11.4578
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_6BL_931C25F08.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding57.53.2e-181459148
                           TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
        Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                           rg++T eE++ +++++++lG++ W+tIa++++ gRt++++k+ w+++l
  Traes_6BL_931C25F08.1 14 RGNFTSEEEDAIIQLHAMLGNR-WSTIAARLP-GRTDNEIKNVWHTHL 59
                           89********************.*********.************986 PP
Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.1E-7121IPR009057Homeodomain-like
SuperFamilySSF466895.39E-20167IPR009057Homeodomain-like
PROSITE profilePS5129426.014963IPR017930Myb domain
SMARTSM007171.4E-141361IPR001005SANT/Myb domain
PfamPF002492.4E-161459IPR001005SANT/Myb domain
CDDcd001671.37E-101659No hitNo description
Gene3DG3DSA:1.10.10.609.1E-242260IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 83 aa     Download sequence    Send to blast
RLRWINYLRP DIKRGNFTSE EEDAIIQLHA MLGNRWSTIA ARLPGRTDNE IKNVWHTHLK  60
KRLASSSKTS GQAAPKHKAK KPP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-1616546110B-MYB
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor involved in cold-regulation of CBF genes and in the development of freezing tolerance. May be part of a complex network of transcription factors controlling the expression of CBF genes and other genes in response to cold stress. Binds to the MYB recognition sequences in the promoters of CBF1, CBF2 and CBF3 genes (PubMed:17015446). Involved in drought and salt tolerance. May enhance expression levels of genes involved in abscisic acid (ABA) biosynthesis and signaling, as well as those encoding stress-protective proteins (PubMed:19161942). {ECO:0000269|PubMed:17015446, ECO:0000269|PubMed:19161942}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by abscisic acid (ABA) and drought stress (PubMed:19161942). Induced by salt stress (PubMed:19161942). {ECO:0000269|PubMed:19161942}.
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankGU0116871e-116GU011687.1 Leymus multicaulis MYB1 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020169007.14e-51myb-related protein Myb4-like
SwissprotQ9LTC49e-37MYB15_ARATH; Transcription factor MYB15
TrEMBLA0A3B6PP775e-54A0A3B6PP77_WHEAT; Uncharacterized protein
TrEMBLA0A446WEV25e-54A0A446WEV2_TRITD; Uncharacterized protein
STRINGTraes_6BL_931C25F08.15e-55(Triticum aestivum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP7938563
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G23250.16e-38myb domain protein 15
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]
  2. Schnaubelt D, et al.
    Low glutathione regulates gene expression and the redox potentials of the nucleus and cytosol in Arabidopsis thaliana.
    Plant Cell Environ., 2015. 38(2): p. 266-79
    [PMID:24329757]
  3. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  4. Ma X, et al.
    CYCLIN-DEPENDENT KINASE G2 regulates salinity stress response and salt mediated flowering in Arabidopsis thaliana.
    Plant Mol. Biol., 2015. 88(3): p. 287-99
    [PMID:25948280]
  5. Kim SH, et al.
    Phosphorylation of the transcriptional repressor MYB15 by mitogen-activated protein kinase 6 is required for freezing tolerance in Arabidopsis.
    Nucleic Acids Res., 2017. 45(11): p. 6613-6627
    [PMID:28510716]
  6. Chezem WR,Memon A,Li FS,Weng JK,Clay NK
    SG2-Type R2R3-MYB Transcription Factor MYB15 Controls Defense-Induced Lignification and Basal Immunity in Arabidopsis.
    Plant Cell, 2017. 29(8): p. 1907-1926
    [PMID:28733420]
  7. Pal S, et al.
    TransDetect Identifies a New Regulatory Module Controlling Phosphate Accumulation.
    Plant Physiol., 2017. 175(2): p. 916-926
    [PMID:28827455]