PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

AT3G23250.1

Common Name

ATMYB15, ATY19, MYB15

Organism

Arabidopsis thaliana

Taxonomic ID

3702

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis

Family

MYB

Protein Properties

Length: 285aa MW: 32041.7 Da PI: 4.9936

Description

myb domain protein 15

Gene Model

Gene Model ID	Type	Source	Coding Sequence
AT3G23250.1	genome	TAIR	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	52.5	1.1e-16	14	61	1	48
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg+WT+eEd++lv + +G +W++ ++ g+ R++k+c++rw +yl AT3G23250.1 14 RGPWTPEEDQILVSFILNHGHSNWRALPKQAGLLRCGKSCRLRWMNYL 61 89****************************99**********97 PP
2	Myb_DNA-binding	51.7	1.9e-16	67	112	1	48
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg++T+eE++ ++ +++ lG++ W++Ia++++ gRt++++k+ w+++l AT3G23250.1 67 RGNFTKEEEDAIISLHQILGNR-WSAIAAKLP-GRTDNEIKNVWHTHL 112 89******************.*****.**********986 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51294	15.547	9	61	IPR017930	Myb domain
SuperFamily	SSF46689	5.5E-30	10	108	IPR009057	Homeodomain-like
SMART	SM00717	1.8E-12	13	63	IPR001005	SANT/Myb domain
Pfam	PF00249	4.4E-15	14	61	IPR001005	SANT/Myb domain
Gene3D	G3DSA:1.10.10.60	1.3E-24	15	68	IPR009057	Homeodomain-like
CDD	cd00167	1.31E-9	16	61	No hit	No description
PROSITE profile	PS51294	25.064	62	116	IPR017930	Myb domain
SMART	SM00717	7.3E-15	66	114	IPR001005	SANT/Myb domain
Pfam	PF00249	6.7E-15	67	112	IPR001005	SANT/Myb domain
Gene3D	G3DSA:1.10.10.60	1.2E-26	69	116	IPR009057	Homeodomain-like
CDD	cd00167	6.93E-11	69	112	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006357	Biological Process	regulation of transcription from RNA polymerase II promoter
GO:0009651	Biological Process	response to salt stress
GO:0009723	Biological Process	response to ethylene
GO:0009733	Biological Process	response to auxin
GO:0009753	Biological Process	response to jasmonic acid
GO:0010200	Biological Process	response to chitin
GO:0030154	Biological Process	cell differentiation
GO:0046686	Biological Process	response to cadmium ion
GO:0005634	Cellular Component	nucleus
GO:0000981	Molecular Function	RNA polymerase II transcription factor activity, sequence-specific DNA binding
GO:0001135	Molecular Function	transcription factor activity, RNA polymerase II transcription factor recruiting
GO:0043565	Molecular Function	sequence-specific DNA binding
GO:0044212	Molecular Function	transcription regulatory region DNA binding

Plant Ontology ? help Back to Top
PO Term	PO Category	PO Description
PO:0000037	anatomy	shoot apex
PO:0000293	anatomy	guard cell
PO:0009005	anatomy	root
PO:0009025	anatomy	vascular leaf
PO:0009029	anatomy	stamen
PO:0009031	anatomy	sepal
PO:0009047	anatomy	stem
PO:0020030	anatomy	cotyledon
PO:0020100	anatomy	hypocotyl
PO:0020137	anatomy	leaf apex
PO:0025022	anatomy	collective leaf structure
PO:0007064	developmental stage	LP.12 twelve leaves visible stage
PO:0007095	developmental stage	LP.08 eight leaves visible stage
PO:0007103	developmental stage	LP.10 ten leaves visible stage
PO:0007115	developmental stage	LP.04 four leaves visible stage
PO:0007123	developmental stage	LP.06 six leaves visible stage
PO:0007616	developmental stage	flowering stage

Sequence ? help Back to Top
Protein Sequence Length: 285 aa Download sequence Send to blast
MGRAPCCEKM GLKRGPWTPE EDQILVSFIL NHGHSNWRAL PKQAGLLRCG KSCRLRWMNY 60 LKPDIKRGNF TKEEEDAIIS LHQILGNRWS AIAAKLPGRT DNEIKNVWHT HLKKRLEDYQ 120 PAKPKTSNKK KGTKPKSESV ITSSNSTRSE SELADSSNPS GESLFSTSPS TSEVSSMTLI 180 SHDGYSNEIN MDNKPGDIST IDQECVSFET FGADIDESFW KETLYSQDEH NYVSNDLEVA 240 GLVEIQQEFQ NLGSANNEMI FDSEMDFWFD VLARTGGEQD LLAGL

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1a5j_A	5e-27	12	117	5	109	B-MYB
Search in ModeBase

Expression -- UniGene ? help Back to Top
UniGene ID	E-value	Expressed in
At.5348	0.0	leaf\| seed

Expression -- Microarray ? help Back to Top
Source	ID	E-value
Genevisible	257919_at	0.0
Expression Atlas	AT3G23250	-
AtGenExpress	AT3G23250	-
ATTED-II	AT3G23250	-

Expression -- Description ? help Back to Top
Source	Description
Uniprot	TISSUE SPECIFICITY: Expressed in roots, leaves, stems and flowers (PubMed:17015446, PubMed:19161942). Expressed in stomatal guard cells (PubMed:19161942). {ECO:0000269\|PubMed:17015446, ECO:0000269\|PubMed:19161942}.

Functional Description ? help Back to Top
Source	Description
TAIR	Member of the R2R3 factor gene family.
UniProt	Transcription factor involved in cold-regulation of CBF genes and in the development of freezing tolerance. May be part of a complex network of transcription factors controlling the expression of CBF genes and other genes in response to cold stress. Binds to the MYB recognition sequences in the promoters of CBF1, CBF2 and CBF3 genes (PubMed:17015446). Involved in drought and salt tolerance. May enhance expression levels of genes involved in abscisic acid (ABA) biosynthesis and signaling, as well as those encoding stress-protective proteins (PubMed:19161942). {ECO:0000269\|PubMed:17015446, ECO:0000269\|PubMed:19161942}.

Function -- GeneRIF ? help Back to Top
myb15 mutant plants show increased tolerance to freezing stress whereas its overexpression reduces freezing tolerance [PMID: 17015446] transgenic expression of MYB15, encoding a R2R3 MYB transcription factor in Arabidopsis thaliana, conferred hypersensitivity to exogenous abscisic acid (ABA) and improved tolerance to drought and salt stresses [PMID: 19161942] Data show that constitutive expression of aminocyclopropane-1-carboxylate oxidase gene, TaACO1 in Arabidopsis increased AtMYB15 expression. [PMID: 25048023] MPK6-mediated regulation of MYB15 plays an important role in cold stress signaling in Arabidopsis. [PMID: 28510716] the Arabidopsis thaliana SG2-type R2R3-MYB transcription factor MYB15 is a regulator of defense-induced lignification and basal immunity. [PMID: 28733420]

Binding Motif ? help Back to Top
Motif ID	Method	Source	Motif file
MP00375	DAP	27203113	Download

Cis-element ? help Back to Top
Source	Link
PlantRegMap	AT3G23250.1

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Induced by abscisic acid (ABA) and drought stress (PubMed:19161942). Induced by salt stress (PubMed:19161942). {ECO:0000269\|PubMed:19161942}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	Retrieve

Regulation -- ATRM (Manually Curated Upstream Regulators) ? help Back to Top
Source	Upstream Regulator (A: Activate/R: Repress)
ATRM	AT3G26744 (R)

Regulation -- ATRM (Manually Curated Target Genes) ? help Back to Top
Source	Target Gene (A: Activate/R: Repress)
ATRM	AT4G25470(R), AT4G25480(R), AT4G25490(R)

Regulation -- Hormone ? help Back to Top
Source	Hormone
AHD	auxin, ethylene, jasmonic acid

Interaction ? help Back to Top
Source	Intact With
BioGRID	AT3G26744

Phenotype -- Mutation ? help Back to Top
Source	ID
T-DNA Express	AT3G23250

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AK176617	0.0	AK176617.1 Arabidopsis thaliana mRNA for putative myb-related transcription factor, complete cds, clone: RAFL25-14-I20.
GenBank	AK176693	0.0	AK176693.1 Arabidopsis thaliana mRNA for putative myb-related transcription factor, complete cds, clone: RAFL25-23-N24.
GenBank	AY550296	0.0	AY550296.1 Arabidopsis thaliana MYB transcription factor (At3g23250) mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	NP_188966.1	0.0	myb domain protein 15
Swissprot	Q9LTC4	0.0	MYB15_ARATH; Transcription factor MYB15
TrEMBL	A0A178V7L7	0.0	A0A178V7L7_ARATH; MYB15
STRING	AT3G23250.1	0.0	(Arabidopsis thaliana)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM4	28	2646
Representative plant	OGRP5	17	1784

Link Out ? help Back to Top
Phytozome	AT3G23250.1
Entrez Gene	821904
iHOP	AT3G23250
wikigenes	AT3G23250

Publications ? help Back to Top
Riechmann JL, et al. Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes. Science, 2000. 290(5499): p. 2105-10 [PMID:11118137] Stracke R,Werber M,Weisshaar B The R2R3-MYB gene family in Arabidopsis thaliana. Curr. Opin. Plant Biol., 2001. 4(5): p. 447-56 [PMID:11597504] Boisson B,Giglione C,Meinnel T Unexpected protein families including cell defense components feature in the N-myristoylome of a higher eukaryote. J. Biol. Chem., 2003. 278(44): p. 43418-29 [PMID:12912986] Guan Y,Nothnagel EA Binding of arabinogalactan proteins by Yariv phenylglycoside triggers wound-like responses in Arabidopsis cell cultures. Plant Physiol., 2004. 135(3): p. 1346-66 [PMID:15235117] Miao Y,Laun T,Zimmermann P,Zentgraf U Targets of the WRKY53 transcription factor and its role during leaf senescence in Arabidopsis. Plant Mol. Biol., 2004. 55(6): p. 853-67 [PMID:15604721] Suzuki N, et al. Enhanced tolerance to environmental stress in transgenic plants expressing the transcriptional coactivator multiprotein bridging factor 1c. Plant Physiol., 2005. 139(3): p. 1313-22 [PMID:16244138] Taki N, et al. 12-oxo-phytodienoic acid triggers expression of a distinct set of genes and plays a role in wound-induced gene expression in Arabidopsis. Plant Physiol., 2005. 139(3): p. 1268-83 [PMID:16258017] Yanhui C, et al. The MYB transcription factor superfamily of Arabidopsis: expression analysis and phylogenetic comparison with the rice MYB family. Plant Mol. Biol., 2006. 60(1): p. 107-24 [PMID:16463103] Thilmony R,Underwood W,He SY Genome-wide transcriptional analysis of the Arabidopsis thaliana interaction with the plant pathogen Pseudomonas syringae pv. tomato DC3000 and the human pathogen Escherichia coli O157:H7. Plant J., 2006. 46(1): p. 34-53 [PMID:16553894] Rigola D,Fiers M,Vurro E,Aarts MG The heavy metal hyperaccumulator Thlaspi caerulescens expresses many species-specific genes, as identified by comparative expressed sequence tag analysis. New Phytol., 2006. 170(4): p. 753-65 [PMID:16684236] Zheng W, et al. Bestatin, an inhibitor of aminopeptidases, provides a chemical genetics approach to dissect jasmonate signaling in Arabidopsis. Plant Physiol., 2006. 141(4): p. 1400-13 [PMID:16798948] Agarwal M, et al. A R2R3 type MYB transcription factor is involved in the cold regulation of CBF genes and in acquired freezing tolerance. J. Biol. Chem., 2006. 281(49): p. 37636-45 [PMID:17015446] Jiang Y,Deyholos MK Comprehensive transcriptional profiling of NaCl-stressed Arabidopsis roots reveals novel classes of responsive genes. BMC Plant Biol., 2006. 6: p. 25 [PMID:17038189] Miura K, et al. SIZ1-mediated sumoylation of ICE1 controls CBF3/DREB1A expression and freezing tolerance in Arabidopsis. Plant Cell, 2007. 19(4): p. 1403-14 [PMID:17416732] Gonzalez D,Bowen AJ,Carroll TS,Conlan RS The transcription corepressor LEUNIG interacts with the histone deacetylase HDA19 and mediator components MED14 (SWP) and CDK8 (HEN3) to repress transcription. Mol. Cell. Biol., 2007. 27(15): p. 5306-15 [PMID:17526732] Libault M,Wan J,Czechowski T,Udvardi M,Stacey G Identification of 118 Arabidopsis transcription factor and 30 ubiquitin-ligase genes responding to chitin, a plant-defense elicitor. Mol. Plant Microbe Interact., 2007. 20(8): p. 900-11 [PMID:17722694] Ehlting J, et al. Comparative transcriptome analysis of Arabidopsis thaliana infested by diamond back moth (Plutella xylostella) larvae reveals signatures of stress response, secondary metabolism, and signalling. BMC Genomics, 2008. 9: p. 154 [PMID:18400103] Ding Z, et al. Transgenic expression of MYB15 confers enhanced sensitivity to abscisic acid and improved drought tolerance in Arabidopsis thaliana. J Genet Genomics, 2009. 36(1): p. 17-29 [PMID:19161942] Lippold F, et al. AtMyb41 regulates transcriptional and metabolic responses to osmotic stress in Arabidopsis. Plant Physiol., 2009. 149(4): p. 1761-72 [PMID:19211694] Eckardt NA CAMTA proteins: a direct link between calcium signals and cold acclimation? Plant Cell, 2009. 21(3): p. 697 [PMID:19270185] Doherty CJ,Van Buskirk HA,Myers SJ,Thomashow MF Roles for Arabidopsis CAMTA transcription factors in cold-regulated gene expression and freezing tolerance. Plant Cell, 2009. 21(3): p. 972-84 [PMID:19270186] Miura K,Hasegawa PM Regulation of cold signaling by sumoylation of ICE1. Plant Signal Behav, 2008. 3(1): p. 52-3 [PMID:19704769] Chen CC,Liang CS,Kao AL,Yang CC HHP1, a novel signalling component in the cross-talk between the cold and osmotic signalling pathways in Arabidopsis. J. Exp. Bot., 2010. 61(12): p. 3305-20 [PMID:20566565] Li C, et al. TaCHP: a wheat zinc finger protein gene down-regulated by abscisic acid and salinity stress plays a positive role in stress tolerance. Plant Physiol., 2010. 154(1): p. 211-21 [PMID:20639406] Liu R, et al. Thirty-seven transcription factor genes differentially respond to a harpin protein and affect resistance to the green peach aphid in Arabidopsis. J. Biosci., 2010. 35(3): p. 435-50 [PMID:20826953] Causier B,Ashworth M,Guo W,Davies B The TOPLESS interactome: a framework for gene repression in Arabidopsis. Plant Physiol., 2012. 158(1): p. 423-38 [PMID:22065421] Efroni I, et al. Regulation of leaf maturation by chromatin-mediated modulation of cytokinin responses. Dev. Cell, 2013. 24(4): p. 438-45 [PMID:23449474] H The R2R3-MYB transcription factors MYB14 and MYB15 regulate stilbene biosynthesis in Vitis vinifera. Plant Cell, 2013. 25(10): p. 4135-49 [PMID:24151295] Schnaubelt D, et al. Low glutathione regulates gene expression and the redox potentials of the nucleus and cytosol in Arabidopsis thaliana. Plant Cell Environ., 2015. 38(2): p. 266-79 [PMID:24329757] Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Chen D, et al. A wheat aminocyclopropane-1-carboxylate oxidase gene, TaACO1, negatively regulates salinity stress in Arabidopsis thaliana. Plant Cell Rep., 2014. 33(11): p. 1815-27 [PMID:25048023] Jin J, et al. An Arabidopsis Transcriptional Regulatory Map Reveals Distinct Functional and Evolutionary Features of Novel Transcription Factors. Mol. Biol. Evol., 2015. 32(7): p. 1767-73 [PMID:25750178] Ma X, et al. CYCLIN-DEPENDENT KINASE G2 regulates salinity stress response and salt mediated flowering in Arabidopsis thaliana. Plant Mol. Biol., 2015. 88(3): p. 287-99 [PMID:25948280] Kim SH, et al. Phosphorylation of the transcriptional repressor MYB15 by mitogen-activated protein kinase 6 is required for freezing tolerance in Arabidopsis. Nucleic Acids Res., 2017. 45(11): p. 6613-6627 [PMID:28510716] Chezem WR,Memon A,Li FS,Weng JK,Clay NK SG2-Type R2R3-MYB Transcription Factor MYB15 Controls Defense-Induced Lignification and Basal Immunity in Arabidopsis. Plant Cell, 2017. 29(8): p. 1907-1926 [PMID:28733420] Pal S, et al. TransDetect Identifies a New Regulatory Module Controlling Phosphate Accumulation. Plant Physiol., 2017. 175(2): p. 916-926 [PMID:28827455] Kranz HD, et al. Towards functional characterisation of the members of the R2R3-MYB gene family from Arabidopsis thaliana. Plant J., 1998. 16(2): p. 263-76 [PMID:9839469]