PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Traes_6BL_7755E4A8A.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 114aa MW: 12992 Da PI: 9.2816 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 50.5 | 4.9e-16 | 14 | 62 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT.-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGgg.tWktIartmgkgRtlkqcksrwqkyl 48 +g+W++eEd +l+ ++ + G+g +W + ++++g++R++k+c++rw++yl Traes_6BL_7755E4A8A.1 14 KGPWSPEEDAKLKAYIDENGTGgNWIALPQKIGLKRCGKSCRLRWLNYL 62 79**********************************************7 PP | |||||||
2 | Myb_DNA-binding | 41.7 | 2.7e-13 | 69 | 111 | 2 | 46 |
SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS Myb_DNA-binding 2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 g +T+eE+ ++ + G++ W+ Ia+ ++ gRt++++k++w++ Traes_6BL_7755E4A8A.1 69 GDFTEEEEHIICSLYISIGSR-WSIIAAQLP-GRTDNDIKNYWNT 111 789******************.*********.***********97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 13.946 | 9 | 62 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 1.0E-26 | 12 | 109 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 2.5E-11 | 13 | 64 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 3.6E-15 | 14 | 62 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 1.8E-24 | 15 | 69 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 8.85E-8 | 16 | 62 | No hit | No description |
PROSITE profile | PS51294 | 21.144 | 63 | 114 | IPR017930 | Myb domain |
SMART | SM00717 | 7.1E-6 | 67 | 114 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 5.9E-12 | 69 | 111 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 4.2E-22 | 70 | 114 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 7.42E-7 | 71 | 113 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 114 aa Download sequence Send to blast |
MGRAPCCDKA TVKKGPWSPE EDAKLKAYID ENGTGGNWIA LPQKIGLKRC GKSCRLRWLN 60 YLRPNIKHGD FTEEEEHIIC SLYISIGSRW SIIAAQLPGR TDNDIKNYWN TKLK |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1a5j_A | 5e-24 | 14 | 114 | 7 | 105 | B-MYB |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription activator (By similarity). Positively regulates axillary meristems (AMs) formation and development, especially during inflorescence. {ECO:0000250, ECO:0000269|PubMed:16461581}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020186660.1 | 2e-82 | transcription factor MYB36-like | ||||
Swissprot | Q9M2Y9 | 5e-75 | RAX3_ARATH; Transcription factor RAX3 | ||||
TrEMBL | A0A3B6NVB3 | 3e-81 | A0A3B6NVB3_WHEAT; Uncharacterized protein | ||||
TrEMBL | A0A3B6PR77 | 3e-81 | A0A3B6PR77_WHEAT; Uncharacterized protein | ||||
TrEMBL | A0A3B6QLP9 | 4e-81 | A0A3B6QLP9_WHEAT; Uncharacterized protein | ||||
TrEMBL | A0A446WP13 | 3e-81 | A0A446WP13_TRITD; Uncharacterized protein | ||||
STRING | Traes_6AL_FF1508B19.1 | 6e-82 | (Triticum aestivum) | ||||
STRING | Traes_6DL_29EF04226.1 | 8e-82 | (Triticum aestivum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP135 | 38 | 412 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G49690.1 | 2e-77 | myb domain protein 84 |
Publications ? help Back to Top | |||
---|---|---|---|
|