PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Traes_5DS_3EBE121C7.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
|
||||||||
Family | M-type_MADS | ||||||||
Protein Properties | Length: 108aa MW: 12156 Da PI: 10.6051 | ||||||||
Description | M-type_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 85.6 | 2.8e-27 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 +ri+n +nrqvtfskRr g++KKA EL +LCda+ a+i+fsstg+ly+++s Traes_5DS_3EBE121C7.1 9 ERIDNATNRQVTFSKRRGGLMKKARELAILCDADLALIVFSSTGRLYDFAS 59 69***********************************************86 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00432 | 1.1E-38 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS50066 | 31.328 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 6.05E-43 | 2 | 77 | No hit | No description |
SuperFamily | SSF55455 | 4.71E-32 | 2 | 90 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.8E-28 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 2.5E-25 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.8E-28 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.8E-28 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 108 aa Download sequence Send to blast |
MGRGKIAIER IDNATNRQVT FSKRRGGLMK KARELAILCD ADLALIVFSS TGRLYDFASS 60 SGMEAILERY QEAKQEHCGV LNPTSEVVAW WRDASKLRRR LVLWRGGG |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5f28_A | 1e-23 | 1 | 77 | 1 | 76 | MEF2C |
5f28_B | 1e-23 | 1 | 77 | 1 | 76 | MEF2C |
5f28_C | 1e-23 | 1 | 77 | 1 | 76 | MEF2C |
5f28_D | 1e-23 | 1 | 77 | 1 | 76 | MEF2C |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AM502902 | 1e-133 | AM502902.1 Triticum aestivum mRNA for MIKC-type MADS-box transcription factor WM31B (WM31B gene). |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020171925.1 | 8e-61 | MADS-box transcription factor 25-like | ||||
Swissprot | Q84NC5 | 3e-48 | MAD25_ORYSJ; MADS-box transcription factor 25 | ||||
TrEMBL | A0A3B6MJ42 | 5e-60 | A0A3B6MJ42_WHEAT; Uncharacterized protein | ||||
TrEMBL | A0A446SLG3 | 1e-59 | A0A446SLG3_TRITD; Uncharacterized protein | ||||
TrEMBL | A0A453JE44 | 2e-59 | A0A453JE44_AEGTS; Uncharacterized protein | ||||
TrEMBL | A0A453JEH2 | 4e-60 | A0A453JEH2_AEGTS; Uncharacterized protein | ||||
TrEMBL | A0A453JEH8 | 5e-60 | A0A453JEH8_AEGTS; Uncharacterized protein | ||||
STRING | Traes_5DS_3EBE121C7.1 | 1e-73 | (Triticum aestivum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP129 | 38 | 398 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G37940.1 | 9e-32 | AGAMOUS-like 21 |
Publications ? help Back to Top | |||
---|---|---|---|
|