PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Traes_5BL_3C5BB24D7.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 105aa MW: 11921.6 Da PI: 9.9705 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 97.7 | 1.8e-30 | 3 | 77 | 55 | 129 |
NAM 55 ekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrle 129 e++wyf++++d++ ++g ++nratk gyWkatgkdke+l+++ +l+g kktLvfykgrap+ge+t+Wvmheyrle Traes_5BL_3C5BB24D7.1 3 ENKWYFYCQKDHEDPSGIQTNRATKVGYWKATGKDKEILDSTPALIGKKKTLVFYKGRAPTGEETKWVMHEYRLE 77 789**********************************************************************85 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51005 | 30.615 | 1 | 98 | IPR003441 | NAC domain |
SuperFamily | SSF101941 | 7.32E-29 | 2 | 81 | IPR003441 | NAC domain |
Pfam | PF02365 | 5.5E-16 | 6 | 76 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 105 aa Download sequence Send to blast |
MGENKWYFYC QKDHEDPSGI QTNRATKVGY WKATGKDKEI LDSTPALIGK KKTLVFYKGR 60 APTGEETKWV MHEYRLEIGK QLTSSLSTDI SKATIINASS KVFKT |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
3swm_A | 3e-21 | 1 | 76 | 71 | 145 | NAC domain-containing protein 19 |
3swm_B | 3e-21 | 1 | 76 | 71 | 145 | NAC domain-containing protein 19 |
3swm_C | 3e-21 | 1 | 76 | 71 | 145 | NAC domain-containing protein 19 |
3swm_D | 3e-21 | 1 | 76 | 71 | 145 | NAC domain-containing protein 19 |
3swp_A | 3e-21 | 1 | 76 | 71 | 145 | NAC domain-containing protein 19 |
3swp_B | 3e-21 | 1 | 76 | 71 | 145 | NAC domain-containing protein 19 |
3swp_C | 3e-21 | 1 | 76 | 71 | 145 | NAC domain-containing protein 19 |
3swp_D | 3e-21 | 1 | 76 | 71 | 145 | NAC domain-containing protein 19 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Binds to the promoter regions of genes involved in chlorophyll catabolic processes, such as NYC1, SGR1, SGR2 and PAO. {ECO:0000269|PubMed:27021284}. | |||||
UniProt | Transcription activator that binds to DNA in promoters of target genes on a specific bipartite motif 5'-[AG]CGT[AG](4-5n)[AG][CT]ACGCAA-3' (PubMed:16359384, PubMed:21303842). Triggers the expression of senescence-associated genes during age-, salt- and dark-induced senescence through a regulatory network that may involve cross-talk with salt- and H(2)O(2)-dependent signaling pathways (PubMed:21303842). {ECO:0000269|PubMed:16359384, ECO:0000269|PubMed:21303842}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Rapidly and strongly induced by H(2)O(2) treatment in both leaves and roots. Accumulates during senescence and in response to wounding. {ECO:0000269|PubMed:21303842}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020191194.1 | 3e-46 | NAC domain-containing protein 100-like | ||||
Swissprot | Q9FK44 | 3e-33 | NAC87_ARATH; NAC domain-containing protein 87 | ||||
Swissprot | Q9LJW3 | 3e-33 | NAC59_ARATH; NAC domain-containing protein 59 | ||||
TrEMBL | A0A446UC92 | 5e-72 | A0A446UC92_TRITD; Uncharacterized protein | ||||
STRING | Traes_5BL_3C5BB24D7.1 | 8e-73 | (Triticum aestivum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP27555 | 3 | 5 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G18270.2 | 1e-35 | Arabidopsis NAC domain containing protein 87 |
Publications ? help Back to Top | |||
---|---|---|---|
|