PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_5BL_3C5BB24D7.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family NAC
Protein Properties Length: 105aa    MW: 11921.6 Da    PI: 9.9705
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_5BL_3C5BB24D7.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM97.71.8e-3037755129
                    NAM  55 ekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrle 129
                            e++wyf++++d++ ++g ++nratk gyWkatgkdke+l+++ +l+g kktLvfykgrap+ge+t+Wvmheyrle
  Traes_5BL_3C5BB24D7.1   3 ENKWYFYCQKDHEDPSGIQTNRATKVGYWKATGKDKEILDSTPALIGKKKTLVFYKGRAPTGEETKWVMHEYRLE 77 
                            789**********************************************************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100530.615198IPR003441NAC domain
SuperFamilySSF1019417.32E-29281IPR003441NAC domain
PfamPF023655.5E-16676IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 105 aa     Download sequence    Send to blast
MGENKWYFYC QKDHEDPSGI QTNRATKVGY WKATGKDKEI LDSTPALIGK KKTLVFYKGR  60
APTGEETKWV MHEYRLEIGK QLTSSLSTDI SKATIINASS KVFKT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swm_A3e-2117671145NAC domain-containing protein 19
3swm_B3e-2117671145NAC domain-containing protein 19
3swm_C3e-2117671145NAC domain-containing protein 19
3swm_D3e-2117671145NAC domain-containing protein 19
3swp_A3e-2117671145NAC domain-containing protein 19
3swp_B3e-2117671145NAC domain-containing protein 19
3swp_C3e-2117671145NAC domain-containing protein 19
3swp_D3e-2117671145NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtBinds to the promoter regions of genes involved in chlorophyll catabolic processes, such as NYC1, SGR1, SGR2 and PAO. {ECO:0000269|PubMed:27021284}.
UniProtTranscription activator that binds to DNA in promoters of target genes on a specific bipartite motif 5'-[AG]CGT[AG](4-5n)[AG][CT]ACGCAA-3' (PubMed:16359384, PubMed:21303842). Triggers the expression of senescence-associated genes during age-, salt- and dark-induced senescence through a regulatory network that may involve cross-talk with salt- and H(2)O(2)-dependent signaling pathways (PubMed:21303842). {ECO:0000269|PubMed:16359384, ECO:0000269|PubMed:21303842}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Rapidly and strongly induced by H(2)O(2) treatment in both leaves and roots. Accumulates during senescence and in response to wounding. {ECO:0000269|PubMed:21303842}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020191194.13e-46NAC domain-containing protein 100-like
SwissprotQ9FK443e-33NAC87_ARATH; NAC domain-containing protein 87
SwissprotQ9LJW33e-33NAC59_ARATH; NAC domain-containing protein 59
TrEMBLA0A446UC925e-72A0A446UC92_TRITD; Uncharacterized protein
STRINGTraes_5BL_3C5BB24D7.18e-73(Triticum aestivum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP2755535
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G18270.21e-35Arabidopsis NAC domain containing protein 87
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]
  3. Manacorda CA, et al.
    Salicylic acid determines differential senescence produced by two Turnip mosaic virus strains involving reactive oxygen species and early transcriptomic changes.
    Mol. Plant Microbe Interact., 2013. 26(12): p. 1486-98
    [PMID:23945002]
  4. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]