PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Traes_5AL_9775A72F6.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
|
||||||||
Family | FAR1 | ||||||||
Protein Properties | Length: 88aa MW: 10651.1 Da PI: 9.7231 | ||||||||
Description | FAR1 family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | FAR1 | 44.4 | 5.5e-14 | 20 | 78 | 1 | 59 |
FAR1 1 kfYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkktekerrtraetr 59 +fYn+YA e GFsvrk + + + n +i+ r++vCs+eg re+++ k++ke r+r+ + Traes_5AL_9775A72F6.1 20 EFYNKYALEKGFSVRKGYVEWDEANVKIIPRKLVCSREGWREDKHMKRKKEDRNRKPRK 78 6*******************************************999777777666544 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Pfam | PF03101 | 8.3E-12 | 20 | 77 | IPR004330 | FAR1 DNA binding domain |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 88 aa Download sequence Send to blast |
MAEYIDIVSE MFDSDDEGFE FYNKYALEKG FSVRKGYVEW DEANVKIIPR KLVCSREGWR 60 EDKHMKRKKE DRNRKPRKES VASRKRTL |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020182137.1 | 3e-33 | protein FAR1-RELATED SEQUENCE 5-like | ||||
TrEMBL | A0A453A3Y5 | 1e-30 | A0A453A3Y5_AEGTS; Uncharacterized protein | ||||
TrEMBL | A0A453ADE7 | 1e-30 | A0A453ADE7_AEGTS; Uncharacterized protein | ||||
TrEMBL | A0A453MYE8 | 2e-31 | A0A453MYE8_AEGTS; Uncharacterized protein | ||||
STRING | Traes_5AL_9775A72F6.1 | 5e-58 | (Triticum aestivum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP2449 | 9 | 76 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G28530.1 | 1e-09 | FAR1-related sequence 10 |
Publications ? help Back to Top | |||
---|---|---|---|
|