PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_4DL_B29067862.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family NAC
Protein Properties Length: 354aa    MW: 38926.9 Da    PI: 7.2649
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_4DL_B29067862.2genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM154.25.9e-48181443128
                    NAM   3 pGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdk 90 
                            pGfrFhPt+eel+ +yL + + gkkl++ ++i +++iy+++PwdLp ++k +e+ewyfF++rd+k+ +g r+nr+t++g+Wkatg+d+
  Traes_4DL_B29067862.2  18 PGFRFHPTEEELLGFYLSRVALGKKLHF-DIIGTLNIYRHDPWDLPGMAKIGEREWYFFVPRDRKAGSGGRPNRTTERGFWKATGSDR 104
                            9*************************99.99***************888999************************************ PP

                    NAM  91 evlsk..kgelvglkktLvfykgrapkgektdWvmheyrl 128
                            ++ s+   ++++glkktLvfy+grap+g+ktdWvm+eyrl
  Traes_4DL_B29067862.2 105 AIRSTadPKRVIGLKKTLVFYQGRAPRGTKTDWVMNEYRL 144
                            ***98777788***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.79E-5810164IPR003441NAC domain
PROSITE profilePS5100555.0316164IPR003441NAC domain
PfamPF023652.4E-2418144IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009965Biological Processleaf morphogenesis
GO:0010200Biological Processresponse to chitin
GO:0045792Biological Processnegative regulation of cell size
GO:0048281Biological Processinflorescence morphogenesis
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 354 aa     Download sequence    Send to blast
MAMAAVASPI MEVDQDLPGF RFHPTEEELL GFYLSRVALG KKLHFDIIGT LNIYRHDPWD  60
LPGMAKIGER EWYFFVPRDR KAGSGGRPNR TTERGFWKAT GSDRAIRSTA DPKRVIGLKK  120
TLVFYQGRAP RGTKTDWVMN EYRLPDNGAP PPQEDTVLCK VYRKATPLKE LEQRAFEIEE  180
MKQRSGSNGG YGYSGAARAC PAACDFYLSP SDDVQDNFLI PSSSSSSSTA PSDNSSSHDA  240
DAPRIAKKEA DVAMVTVAST SSLPQAANAP FHLQLPAVNP PCGLQLPAAN HGMSNMSSLQ  300
LPAASQGVVD LPSLQLPAAS SHRVFDWLND PFLTQLRSPW QDTHCMSPYA HLLY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A2e-471816619167NO APICAL MERISTEM PROTEIN
1ut4_B2e-471816619167NO APICAL MERISTEM PROTEIN
1ut7_A2e-471816619167NO APICAL MERISTEM PROTEIN
1ut7_B2e-471816619167NO APICAL MERISTEM PROTEIN
3swm_A2e-471816622170NAC domain-containing protein 19
3swm_B2e-471816622170NAC domain-containing protein 19
3swm_C2e-471816622170NAC domain-containing protein 19
3swm_D2e-471816622170NAC domain-containing protein 19
3swp_A2e-471816622170NAC domain-containing protein 19
3swp_B2e-471816622170NAC domain-containing protein 19
3swp_C2e-471816622170NAC domain-containing protein 19
3swp_D2e-471816622170NAC domain-containing protein 19
4dul_A2e-471816619167NAC domain-containing protein 19
4dul_B2e-471816619167NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator that binds sequence-specific DNA motifs. Involved in stress response. Plays a positive role in drought and salt stress tolerance through the modulation of abscisic acid-mediated signaling. {ECO:0000269|PubMed:26834774}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by drought stress, salt stress and abscisic acid (ABA). {ECO:0000269|PubMed:26834774}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3673760.0AK367376.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, partial cds, clone: NIASHv2055P15.
GenBankAK3679630.0AK367963.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, partial cds, clone: NIASHv2065K10.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020190295.10.0NAC domain-containing protein 72-like
SwissprotQ10S651e-146NAC22_ORYSJ; NAC domain-containing protein 22
TrEMBLA0A453J3860.0A0A453J386_AEGTS; Uncharacterized protein
STRINGTraes_4DL_B29067862.20.0(Triticum aestivum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP177038105
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G17040.13e-87NAC domain containing protein 36
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]
  2. Hong Y,Zhang H,Huang L,Li D,Song F
    Overexpression of a Stress-Responsive NAC Transcription Factor Gene ONAC022 Improves Drought and Salt Tolerance in Rice.
    Front Plant Sci, 2016. 7: p. 4
    [PMID:26834774]