PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Traes_4BL_27B9E4CE6.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 86aa MW: 9729.15 Da PI: 6.2422 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 71.1 | 3e-22 | 17 | 83 | 3 | 70 |
NAM 3 pGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyat 70 pGfrFhPt+eel+ +yL + + gkkl++ ++i +++iy+++PwdLp ++k +e+ewyfF++rd+k+ + Traes_4BL_27B9E4CE6.1 17 PGFRFHPTEEELLGFYLSRVALGKKLHF-DIIGTLNIYRHDPWDLPGMAKIGEREWYFFVPRDRKAGS 83 9*************************99.99***************888999************9875 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF101941 | 1.57E-26 | 9 | 85 | IPR003441 | NAC domain |
PROSITE profile | PS51005 | 24.98 | 15 | 86 | IPR003441 | NAC domain |
Pfam | PF02365 | 4.6E-10 | 17 | 82 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 86 aa Download sequence Send to blast |
MAMAVAASTM EVDQDLPGFR FHPTEEELLG FYLSRVALGK KLHFDIIGTL NIYRHDPWDL 60 PGMAKIGERE WYFFVPRDRK AGSGGG |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
3ulx_A | 2e-22 | 17 | 85 | 17 | 85 | Stress-induced transcription factor NAC1 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription activator that binds sequence-specific DNA motifs. Involved in stress response. Plays a positive role in drought and salt stress tolerance through the modulation of abscisic acid-mediated signaling. {ECO:0000269|PubMed:26834774}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Induced by drought stress, salt stress and abscisic acid (ABA). {ECO:0000269|PubMed:26834774}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AK367376 | 1e-102 | AK367376.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, partial cds, clone: NIASHv2055P15. | |||
GenBank | AK367963 | 1e-102 | AK367963.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, partial cds, clone: NIASHv2065K10. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020190294.1 | 3e-56 | NAC domain-containing protein 72-like | ||||
Swissprot | Q10S65 | 2e-50 | NAC22_ORYSJ; NAC domain-containing protein 22 | ||||
TrEMBL | A0A3B6IWH5 | 7e-55 | A0A3B6IWH5_WHEAT; Uncharacterized protein | ||||
TrEMBL | A0A3B6JNX9 | 7e-55 | A0A3B6JNX9_WHEAT; Uncharacterized protein | ||||
TrEMBL | A0A446SGT0 | 4e-56 | A0A446SGT0_TRITD; Uncharacterized protein | ||||
TrEMBL | A0A453J381 | 7e-55 | A0A453J381_AEGTS; Uncharacterized protein | ||||
TrEMBL | A0A453J3M7 | 4e-55 | A0A453J3M7_AEGTS; Uncharacterized protein | ||||
STRING | Traes_4BL_27B9E4CE6.1 | 6e-58 | (Triticum aestivum) | ||||
STRING | Traes_4DL_7CB8EC5A8.1 | 8e-57 | (Triticum aestivum) | ||||
STRING | TRIUR3_32216-P1 | 2e-55 | (Triticum urartu) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP14845 | 11 | 21 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G17040.1 | 3e-38 | NAC domain containing protein 36 |
Publications ? help Back to Top | |||
---|---|---|---|
|