PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Traes_3DL_30CF35BB3.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 76aa MW: 8931.12 Da PI: 9.3177 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 30.8 | 7e-10 | 31 | 70 | 4 | 45 |
S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS Myb_DNA-binding 4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 +T+ E++l + +++ G++ W++Ia +++ gRt++++ +w Traes_3DL_30CF35BB3.1 31 FTEAEEDLVFRMHRLVGNR-WELIAGRIP-GRTAEEVEMFWA 70 9******************.*********.*******99886 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00717 | 1.8E-7 | 27 | 75 | IPR001005 | SANT/Myb domain |
SuperFamily | SSF46689 | 5.23E-9 | 30 | 72 | IPR009057 | Homeodomain-like |
PROSITE profile | PS50090 | 6.655 | 31 | 73 | IPR017877 | Myb-like domain |
CDD | cd00167 | 2.79E-7 | 31 | 69 | No hit | No description |
Pfam | PF00249 | 6.1E-9 | 31 | 70 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 4.6E-12 | 31 | 71 | IPR009057 | Homeodomain-like |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0045892 | Biological Process | negative regulation of transcription, DNA-templated | ||||
GO:1900033 | Biological Process | negative regulation of trichome patterning | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 76 aa Download sequence Send to blast |
MSRESLGKNS KIMGGRERKE VNSTAKHFVD FTEAEEDLVF RMHRLVGNRW ELIAGRIPGR 60 TAEEVEMFWA KRHQDQ |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | MYB-type transcription factor involved in trichome cell specification. Acts as a negative regulator of trichome patterning and formation. May function by suppressing the expression of GL3. {ECO:0000269|PubMed:22168948}. |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | JF951933 | 1e-119 | JF951933.1 Aegilops speltoides clone TaMYB50 MYB-related protein mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020165156.1 | 4e-50 | MYB-like transcription factor TCL2 | ||||
Refseq | XP_020165157.1 | 4e-50 | MYB-like transcription factor TCL2 | ||||
Refseq | XP_020172618.1 | 4e-50 | MYB-like transcription factor TCL2 | ||||
Refseq | XP_020172619.1 | 4e-50 | MYB-like transcription factor TCL2 | ||||
Swissprot | B3H4X8 | 4e-19 | TCL2_ARATH; MYB-like transcription factor TCL2 | ||||
TrEMBL | A0A453F2H5 | 1e-48 | A0A453F2H5_AEGTS; Uncharacterized protein | ||||
STRING | Traes_3DL_30CF35BB3.1 | 2e-49 | (Triticum aestivum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP5275 | 31 | 57 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G30424.1 | 2e-21 | MYB_related family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|