PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Traes_3AL_891566958.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 76aa MW: 8599.84 Da PI: 11.5057 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 30 | 1.2e-09 | 7 | 44 | 10 | 47 |
HHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 10 ellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 l++ + k +G+g+W++I+r + +Rt+ q+ s+ qky Traes_3AL_891566958.1 7 RLFLLGLKTYGKGDWRKISRNFVRTRTPTQVASHAQKY 44 5789999******************************9 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 11.502 | 1 | 49 | IPR017930 | Myb domain |
TIGRFAMs | TIGR01557 | 1.1E-11 | 5 | 47 | IPR006447 | Myb domain, plants |
SuperFamily | SSF46689 | 8.58E-12 | 6 | 49 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 1.53E-7 | 7 | 45 | No hit | No description |
Gene3D | G3DSA:1.10.10.60 | 9.4E-7 | 8 | 44 | IPR009057 | Homeodomain-like |
Pfam | PF00249 | 3.0E-7 | 8 | 44 | IPR001005 | SANT/Myb domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 76 aa Download sequence Send to blast |
MPCSLARLFL LGLKTYGKGD WRKISRNFVR TRTPTQVASH AQKYFIRLSS GTARRSSIHD 60 ITTVHLTDDQ PPSPSQ |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Involved in the dorsovental asymmetry of flowers. Promotes ventral identity. {ECO:0000269|PubMed:11937495, ECO:0000269|PubMed:9118809}. |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | KU857045 | 1e-114 | KU857045.1 Triticum aestivum GID2-A1 protein (gid2-A1) gene, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020200806.1 | 1e-39 | F-box protein GID2-like | ||||
Swissprot | Q8S9H7 | 2e-30 | DIV_ANTMA; Transcription factor DIVARICATA | ||||
TrEMBL | A0A446P634 | 4e-49 | A0A446P634_TRITD; Uncharacterized protein | ||||
STRING | Traes_3AL_891566958.1 | 6e-50 | (Triticum aestivum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP842 | 30 | 133 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G58900.1 | 2e-28 | Homeodomain-like transcriptional regulator |
Publications ? help Back to Top | |||
---|---|---|---|
|