PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Traes_2DS_D0563916C.1

Organism

Triticum aestivum

Taxonomic ID

4565

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum

Family

bZIP

Protein Properties

Length: 50aa MW: 5752.58 Da PI: 11.7781

Description

bZIP family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Traes_2DS_D0563916C.1	genome	IWGSC	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	bZIP_1	36.9	8.1e-12	4	41	13	50
HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 13 NReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkele 50 NR +A+rsR RK+++i eLe+ v +L++e +aL ++ Traes_2DS_D0563916C.1 4 NRQSAQRSRVRKLQYISELERSVTSLQTEVSALSPRVA 41 *****************************999987665 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
CDD	cd14703	3.15E-15	1	47	No hit	No description
PROSITE profile	PS50217	8.634	1	50	IPR004827	Basic-leucine zipper domain
SuperFamily	SSF57959	4.44E-11	2	47	No hit	No description
Gene3D	G3DSA:1.20.5.170	7.6E-14	3	48	No hit	No description
Pfam	PF00170	9.6E-10	3	45	IPR004827	Basic-leucine zipper domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0043565	Molecular Function	sequence-specific DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 50 aa Download sequence Send to blast
ILANRQSAQR SRVRKLQYIS ELERSVTSLQ TEVSALSPRV AFLDHQRSLL

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription regulator. {ECO:0000250}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Down-regulated by dehydration and salt stress. {ECO:0000269\|PubMed:18065552}.

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	BT036821	2e-61	BT036821.1 Zea mays full-length cDNA clone ZM_BFb0141B19 mRNA, complete cds.
GenBank	BT061266	2e-61	BT061266.1 Zea mays full-length cDNA clone ZM_BFb0128B20 mRNA, complete cds.
GenBank	KJ727557	2e-61	KJ727557.1 Zea mays clone pUT5417 bZIP transcription factor (bZIP117) mRNA, partial cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_002454954.1	2e-25	basic leucine zipper 2
Refseq	XP_004968609.1	2e-25	basic leucine zipper 2
Refseq	XP_014753813.1	2e-25	basic leucine zipper 2
Refseq	XP_015694867.1	2e-25	PREDICTED: basic leucine zipper 2-like
Swissprot	Q5QNI5	1e-26	BZP02_ORYSJ; Basic leucine zipper 2
TrEMBL	A0A287KV47	3e-25	A0A287KV47_HORVV; Uncharacterized protein
STRING	BRADI2G06790.1	3e-25	(Brachypodium distachyon)
STRING	Traes_2DS_D0563916C.1	2e-26	(Triticum aestivum)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP17792	7	9

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT3G58120.1	2e-26	bZIP family protein

Publications ? help Back to Top
Kikuchi S, et al. Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice. Science, 2003. 301(5631): p. 376-9 [PMID:12869764] Brenchley R, et al. Analysis of the bread wheat genome using whole-genome shotgun sequencing. Nature, 2012. 491(7426): p. 705-10 [PMID:23192148]