PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

AT3G58120.1

Common Name

ATBZIP61, BZIP61, F9D24.30

Organism

Arabidopsis thaliana

Taxonomic ID

3702

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis

Family

bZIP

Protein Properties

Length: 329aa MW: 36805.2 Da PI: 6.8036

Description

bZIP family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
AT3G58120.1	genome	TAIR	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	bZIP_1	33.2	1.1e-10	204	247	5	48
CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkke 48 kr +r NR +A+rsR RK+++i eLe+ v +L++e + L + AT3G58120.1 204 KRVKRILANRQSAQRSRVRKLQYISELERSVTSLQTEVSVLSPR 247 899********************************998777655 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SMART	SM00338	1.1E-13	200	264	IPR004827	Basic-leucine zipper domain
PROSITE profile	PS50217	9.588	202	254	IPR004827	Basic-leucine zipper domain
SuperFamily	SSF57959	2.49E-11	204	258	No hit	No description
Gene3D	G3DSA:1.20.5.170	3.0E-13	204	255	No hit	No description
Pfam	PF00170	3.0E-9	204	248	IPR004827	Basic-leucine zipper domain
CDD	cd14703	4.24E-24	205	255	No hit	No description
PROSITE pattern	PS00036	0	207	222	IPR004827	Basic-leucine zipper domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0045893	Biological Process	positive regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0000977	Molecular Function	RNA polymerase II regulatory region sequence-specific DNA binding
GO:0003677	Molecular Function	DNA binding
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0005515	Molecular Function	protein binding

Plant Ontology ? help Back to Top
PO Term	PO Category	PO Description
PO:0000013	anatomy	cauline leaf
PO:0000037	anatomy	shoot apex
PO:0000230	anatomy	inflorescence meristem
PO:0000293	anatomy	guard cell
PO:0008019	anatomy	leaf lamina base
PO:0009005	anatomy	root
PO:0009006	anatomy	shoot system
PO:0009009	anatomy	plant embryo
PO:0009010	anatomy	seed
PO:0009025	anatomy	vascular leaf
PO:0009029	anatomy	stamen
PO:0009030	anatomy	carpel
PO:0009031	anatomy	sepal
PO:0009032	anatomy	petal
PO:0009046	anatomy	flower
PO:0020030	anatomy	cotyledon
PO:0020038	anatomy	petiole
PO:0020137	anatomy	leaf apex
PO:0025022	anatomy	collective leaf structure
PO:0025195	anatomy	pollen tube cell
PO:0025281	anatomy	pollen
PO:0001054	developmental stage	vascular leaf senescent stage
PO:0001078	developmental stage	plant embryo cotyledonary stage
PO:0001081	developmental stage	mature plant embryo stage
PO:0004507	developmental stage	plant embryo bilateral stage
PO:0007064	developmental stage	LP.12 twelve leaves visible stage
PO:0007095	developmental stage	LP.08 eight leaves visible stage
PO:0007098	developmental stage	LP.02 two leaves visible stage
PO:0007103	developmental stage	LP.10 ten leaves visible stage
PO:0007115	developmental stage	LP.04 four leaves visible stage
PO:0007123	developmental stage	LP.06 six leaves visible stage
PO:0007611	developmental stage	petal differentiation and expansion stage
PO:0007616	developmental stage	flowering stage

Sequence ? help Back to Top
Protein Sequence Length: 329 aa Download sequence Send to blast
MAQLPPKIPT MTTPNWPDFS SQKLPSIAAT AAAAATAGPQ QQNPSWMDEF LDFSATRRGT 60 HRRSISDSIA FLEPPSSGVG NHHFDRFDDE QFMSMFNDDV HNNNHNHHHH HSINGNVGPT 120 RSSSNTSTPS DHNSLSDDDN NKEAPPSDHD HHMDNNVANQ NNAAGNNYNE SDEVQSQCKT 180 EPQDGPSANQ NSGGSSGNRI HDPKRVKRIL ANRQSAQRSR VRKLQYISEL ERSVTSLQTE 240 VSVLSPRVAF LDHQRLLLNV DNSAIKQRIA ALAQDKIFKD AHQEALKREI ERLRQVYHQQ 300 SLKKMENNVS DQSPADIKPS VEKEQLLNV

Expression -- UniGene ? help Back to Top
UniGene ID	E-value	Expressed in
At.23600	0.0	floral meristem\| seed\| silique

Expression -- Microarray ? help Back to Top
Source	ID	E-value
GEO	42566024	0.0
Genevisible	251575_at	0.0
Expression Atlas	AT3G58120	-
AtGenExpress	AT3G58120	-
ATTED-II	AT3G58120	-

Functional Description ? help Back to Top
Source	Description
TAIR	Encodes a member of the BZIP family of transcription factors. Forms heterodimers with the related protein AtbZIP34. Binds to G-boxes in vitro and is localized to the nucleus in onion epidermal cells.
UniProt	Transcriptional activator. {ECO:0000269\|PubMed:17719007}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	AT3G58120.1

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Interaction ? help Back to Top
Source	Intact With
BioGRID	AT3G58120, AT5G38800, AT1G43700
IntAct	Search Q9M2K4

Phenotype -- Mutation ? help Back to Top
Source	ID
T-DNA Express	AT3G58120

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AF401300	0.0	AF401300.1 Arabidopsis thaliana transcription factor bZIP61 (BZIP61) mRNA, complete cds.
GenBank	AY087356	0.0	AY087356.1 Arabidopsis thaliana clone 34553 mRNA, complete sequence.
GenBank	AY093053	0.0	AY093053.1 Arabidopsis thaliana pelota-like protein (At3g58120) mRNA, complete cds.
GenBank	BT008728	0.0	BT008728.1 Arabidopsis thaliana At3g58120 gene, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	NP_191371.1	0.0	Basic-leucine zipper (bZIP) transcription factor family protein
Swissprot	Q9M2K4	0.0	BZP61_ARATH; Basic leucine zipper 61
TrEMBL	A0A178VLL5	0.0	A0A178VLL5_ARATH; BZIP61
STRING	AT3G58120.1	0.0	(Arabidopsis thaliana)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM1753	27	77
Representative plant	OGRP126	17	181

Link Out ? help Back to Top
Phytozome	AT3G58120.1
Entrez Gene	824981
iHOP	AT3G58120
wikigenes	AT3G58120

Publications ? help Back to Top
Riechmann JL, et al. Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes. Science, 2000. 290(5499): p. 2105-10 [PMID:11118137] Jakoby M, et al. bZIP transcription factors in Arabidopsis. Trends Plant Sci., 2002. 7(3): p. 106-11 [PMID:11906833] Dal Bosco C, et al. Inactivation of the chloroplast ATP synthase gamma subunit results in high non-photochemical fluorescence quenching and altered nuclear gene expression in Arabidopsis thaliana. J. Biol. Chem., 2004. 279(2): p. 1060-9 [PMID:14576160] Satoh R,Fujita Y,Nakashima K,Shinozaki K,Yamaguchi-Shinozaki K A novel subgroup of bZIP proteins functions as transcriptional activators in hypoosmolarity-responsive expression of the ProDH gene in Arabidopsis. Plant Cell Physiol., 2004. 45(3): p. 309-17 [PMID:15047879] Hilson P, et al. Versatile gene-specific sequence tags for Arabidopsis functional genomics: transcript profiling and reverse genetics applications. Genome Res., 2004. 14(10B): p. 2176-89 [PMID:15489341] Coupe SA, et al. Systemic signalling of environmental cues in Arabidopsis leaves. J. Exp. Bot., 2006. 57(2): p. 329-41 [PMID:16330523] Oono Y, et al. Monitoring expression profiles of Arabidopsis genes during cold acclimation and deacclimation using DNA microarrays. Funct. Integr. Genomics, 2006. 6(3): p. 212-34 [PMID:16463051] Kim J,Shiu SH,Thoma S,Li WH,Patterson SE Patterns of expansion and expression divergence in the plant polygalacturonase gene family. Genome Biol., 2006. 7(9): p. R87 [PMID:17010199] Bezhani S, et al. Unique, shared, and redundant roles for the Arabidopsis SWI/SNF chromatin remodeling ATPases BRAHMA and SPLAYED. Plant Cell, 2007. 19(2): p. 403-16 [PMID:17293567] Popescu SC, et al. Differential binding of calmodulin-related proteins to their targets revealed through high-density Arabidopsis protein microarrays. Proc. Natl. Acad. Sci. U.S.A., 2007. 104(11): p. 4730-5 [PMID:17360592] Kleine T,Kindgren P,Benedict C,Hendrickson L,Strand A Genome-wide gene expression analysis reveals a critical role for CRYPTOCHROME1 in the response of Arabidopsis to high irradiance. Plant Physiol., 2007. 144(3): p. 1391-406 [PMID:17478635] Shen H,Cao K,Wang X A conserved proline residue in the leucine zipper region of AtbZIP34 and AtbZIP61 in Arabidopsis thaliana interferes with the formation of homodimer. Biochem. Biophys. Res. Commun., 2007. 362(2): p. 425-30 [PMID:17719007] Huang D,Wu W,Abrams SR,Cutler AJ The relationship of drought-related gene expression in Arabidopsis thaliana to hormonal and environmental factors. J. Exp. Bot., 2008. 59(11): p. 2991-3007 [PMID:18552355] Wang Y, et al. Transcriptome analyses show changes in gene expression to accompany pollen germination and tube growth in Arabidopsis. Plant Physiol., 2008. 148(3): p. 1201-11 [PMID:18775970] Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Gibalová A, et al. Characterization of pollen-expressed bZIP protein interactions and the role of ATbZIP18 in the male gametophyte. Plant Reprod, 2017. 30(1): p. 1-17 [PMID:27896439] Ezer D, et al. The G-Box Transcriptional Regulatory Code in Arabidopsis. Plant Physiol., 2017. 175(2): p. 628-640 [PMID:28864470]