PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Home  TFext  BLAST  Prediction  Download  Help  About  Links  PlantRegMap
(e.g., LFY)
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_2DS_B5227B5F6.1
Organism
Triticum aestivum
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family WOX
Protein Properties Length: 66aa    MW: 7957.17 Da    PI: 12.218
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_2DS_B5227B5F6.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox535.8e-17363257
                           T--SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
               Homeobox  2 rkRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57
                           r+R+t+++eq+ +Le+ F++   +p ++e  ++ k l     + +++V++WFqNrR + ++
  Traes_2DS_B5227B5F6.1  3 RSRWTPKPEQILILESIFNSgMVNPPKDETVRIRKLLerfgAVGDANVFYWFQNRRSRSRR 63
                           89*****************99*************************************997 PP
2Wus_type_Homeobox112.42.4e-36265265
      Wus_type_Homeobox  2 artRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65
                           +r+RWtP+peQi iLe++++sG+++P+k+e+ ri++ Le++G+++d+NVfyWFQNr++R+r++q
  Traes_2DS_B5227B5F6.1  2 VRSRWTPKPEQILILESIFNSGMVNPPKDETVRIRKLLERFGAVGDANVFYWFQNRRSRSRRRQ 65
                           589***********************************************************97 PP
Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003890.0019166IPR001356Homeobox domain
PROSITE profilePS5007111.24164IPR001356Homeobox domain
SuperFamilySSF466895.13E-14366IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.608.2E-9366IPR009057Homeodomain-like
PfamPF000461.1E-14363IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 66 aa     Download sequence    Send to blast
PVRSRWTPKP EQILILESIF NSGMVNPPKD ETVRIRKLLE RFGAVGDANV FYWFQNRRSR  60
SRRRQR
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor involved in crown root development (PubMed:26307379, PubMed:29740464). Promotes the development of crown roots (both initiation and elongation), main components of the fibrous root system (PubMed:26307379, PubMed:29740464). Regulates the expression of genes required for crown root development, and hormone-responsive genes involved in cytokinin signaling (e.g. RR1, RR2, RR3 and RR4), and auxin signaling (e.g. IAA5, IAA11, IAA23 and IAA31) (PubMed:26307379). Functions dowstream of the auxin biosynthetic genes YUCCA1 in the promotion of crown root development (PubMed:29740464). {ECO:0000269|PubMed:26307379, ECO:0000269|PubMed:29740464}.
UniProtTranscription factor which may be involved in developmental processes. {ECO:0000250}.
UniProtTranscription factor which may be involved in developmental processes. {ECO:0000250}.
UniProtTranscription factor which may be involved in developmental processes. Promotes the development of crown roots (both initiation and elongation), main components of the fibrous root system, by regulating the expression of genes required for crown root development and hormone-responsive genes involved in cytokinin (e.g. RR1, RR2, RR3 and RR4) and auxin (e.g. IAA5, IAA11, IAA23 and IAA31) signaling. {ECO:0000250|UniProtKB:Q0D3I7}.
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3706094e-97AK370609.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2113D12.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008655176.11e-42WUSCHEL-related homeobox 6
RefseqXP_012699333.15e-43WUSCHEL-related homeobox 11
SwissprotA2XG772e-43WOX6_ORYSI; WUSCHEL-related homeobox 6
SwissprotB8B6441e-43WOX11_ORYSI; WUSCHEL-related homeobox 11
SwissprotQ0D3I71e-43WOX11_ORYSJ; WUSCHEL-related homeobox 11
SwissprotQ10M293e-43WOX6_ORYSJ; WUSCHEL-related homeobox 6
TrEMBLA0A0D9VTJ04e-42A0A0D9VTJ0_9ORYZ; Uncharacterized protein
TrEMBLA0A0D9X3134e-42A0A0D9X313_9ORYZ; Uncharacterized protein
STRINGLPERR03G13850.17e-43(Leersia perrieri)
STRINGLPERR07G23470.16e-43(Leersia perrieri)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP107837109
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G03660.11e-36WUSCHEL related homeobox 11
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]
  2. Zhao Y, et al.
    The Interaction between Rice ERF3 and WOX11 Promotes Crown Root Development by Regulating Gene Expression Involved in Cytokinin Signaling.
    Plant Cell, 2015. 27(9): p. 2469-83
    [PMID:26307379]
  3. Zhang T, et al.
    The YUCCA-Auxin-WOX11 Module Controls Crown Root Development in Rice.
    Front Plant Sci, 2018. 9: p. 523
    [PMID:29740464]