PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

AT3G03660.1

Common Name

T12J13.6, WOX11

Organism

Arabidopsis thaliana

Taxonomic ID

3702

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis

Family

WOX

Protein Properties

Length: 268aa MW: 29419.5 Da PI: 6.999

Description

WUSCHEL related homeobox 11

Gene Model

Gene Model ID	Type	Source	Coding Sequence
AT3G03660.1	genome	TAIR	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Homeobox	49.6	6.6e-16	31	91	2	57
T--SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS Homeobox 2 rkRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57 r+R+++++eq+ +Le+ F++ +p +ee ++ k l + +++V++WFqNrR + ++ AT3G03660.1 31 RSRWSPKPEQILILESIFHSgMVNPPKEETVRIRKMLekfgAVGDANVFYWFQNRRSRSRR 91 89***************99***********************************997 PP
2	Wus_type_Homeobox	106.8	1.3e-34	30	93	2	65
Wus_type_Homeobox 2 artRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65 +r+RW+P+peQi iLe++++sG+++P+kee+ ri+++Le++G+++d+NVfyWFQNr++R+r++q AT3G03660.1 30 VRSRWSPKPEQILILESIFHSGMVNPPKEETVRIRKMLEKFGAVGDANVFYWFQNRRSRSRRRQ 93 589***********************************************************97 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.10.60	8.4E-9	9	92	IPR009057	Homeodomain-like
SuperFamily	SSF46689	1.07E-14	23	98	IPR009057	Homeodomain-like
PROSITE profile	PS50071	11.645	27	92	IPR001356	Homeobox domain
SMART	SM00389	3.5E-7	29	96	IPR001356	Homeobox domain
Pfam	PF00046	1.1E-13	31	91	IPR001356	Homeobox domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0009734	Biological Process	auxin-activated signaling pathway
GO:0048830	Biological Process	adventitious root development
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 268 aa Download sequence Send to blast
MDQEQTPHSP TRHSRSPPSS ASGSTSAEPV RSRWSPKPEQ ILILESIFHS GMVNPPKEET 60 VRIRKMLEKF GAVGDANVFY WFQNRRSRSR RRQRQLQAAA AAADATTNTC DQTMMVSNSL 120 PHHSGSDLGF GGCSTSSNYL FASSSSSYGG GCDNQSNSGM ENLLTMSGQM SYHEATHHHY 180 QNHSSNVTSI LCPSDQNSNF QYQQGAITVF INGVPTEVTR GGIDMKATFG EDLVLVHSSG 240 VPLPTDEFGF LMHSLQHGEA YFLVPRQT

Expression -- UniGene ? help Back to Top
UniGene ID	E-value	Expressed in
At.40942	0.0	seed

Expression -- Microarray ? help Back to Top
Source	ID	E-value
Genevisible	259223_at	0.0
Expression Atlas	AT3G03660	-
AtGenExpress	AT3G03660	-
ATTED-II	AT3G03660	-

Functional Description ? help Back to Top
Source	Description
TAIR	Encodes a WUSCHEL-related homeobox gene family member with 65 amino acids in its homeodomain. Proteins in this family contain a sequence of eight residues (TLPLFPMH) downstream of the homeodomain called the WUS box.
UniProt	Transcription factor which may be involved in developmental processes. {ECO:0000250}.

Function -- GeneRIF ? help Back to Top
WOX11 directly responds to a wounding-induced auxin maximum in and surrounding the procambium and acts redundantly with its homolog WOX12 to upregulate LATERAL ORGAN BOUNDARIES DOMAIN16 (LBD16) and LBD29 [PMID: 24642937] the expression switch from WOX11/12 to WOX5/7 is critical for initiation of the root primordium during de novo root organogenesis. [PMID: 27784768] The discovery of WOX11-mediated root-derived roots reveals a previously uncharacterized pathway that confers plasticity during the generation of root system architecture in response to different inductive cues. [PMID: 28743799] the WOX11-LBD16 pathway promotes pluripotency acquisition in callus cells. [PMID: 29361138] involved in the formation of new lateral roots from secondary growth taproot [PMID: 29450949]

Binding Motif ? help Back to Top
Motif ID	Method	Source	Motif file
MP00330	DAP	27203113	Download

Cis-element ? help Back to Top
Source	Link
PlantRegMap	AT3G03660.1

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	Retrieve

Phenotype -- Mutation ? help Back to Top
Source	ID
T-DNA Express	AT3G03660

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AY251402	0.0	AY251402.1 Arabidopsis thaliana WOX11 protein mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	NP_187016.2	0.0	WUSCHEL related homeobox 11
Swissprot	Q6X7J3	0.0	WOX11_ARATH; WUSCHEL-related homeobox 11
TrEMBL	A0A1I9LND7	0.0	A0A1I9LND7_ARATH; WUSCHEL related homeobox 11
STRING	AT3G03660.2	1e-174	(Arabidopsis thaliana)

Link Out ? help Back to Top
Phytozome	AT3G03660.1
Entrez Gene	821196
iHOP	AT3G03660
wikigenes	AT3G03660

Publications ? help Back to Top
Riechmann JL, et al. Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes. Science, 2000. 290(5499): p. 2105-10 [PMID:11118137] R Rapid identification of Arabidopsis insertion mutants by non-radioactive detection of T-DNA tagged genes. Plant J., 2002. 32(2): p. 243-53 [PMID:12383089] Dal Bosco C, et al. Inactivation of the chloroplast ATP synthase gamma subunit results in high non-photochemical fluorescence quenching and altered nuclear gene expression in Arabidopsis thaliana. J. Biol. Chem., 2004. 279(2): p. 1060-9 [PMID:14576160] Haecker A, et al. Expression dynamics of WOX genes mark cell fate decisions during early embryonic patterning in Arabidopsis thaliana. Development, 2004. 131(3): p. 657-68 [PMID:14711878] Wagner R,Pfannschmidt T Eukaryotic transcription factors in plastids--Bioinformatic assessment and implications for the evolution of gene expression machineries in plants. Gene, 2006. 381: p. 62-70 [PMID:16934950] Wu X,Chory J,Weigel D Combinations of WOX activities regulate tissue proliferation during Arabidopsis embryonic development. Dev. Biol., 2007. 309(2): p. 306-16 [PMID:17706632] Hirakawa Y,Kondo Y,Fukuda H TDIF peptide signaling regulates vascular stem cell proliferation via the WOX4 homeobox gene in Arabidopsis. Plant Cell, 2010. 22(8): p. 2618-29 [PMID:20729381] Zhang X,Zong J,Liu J,Yin J,Zhang D Genome-wide analysis of WOX gene family in rice, sorghum, maize, Arabidopsis and poplar. J Integr Plant Biol, 2010. 52(11): p. 1016-26 [PMID:20977659] Liu J, et al. WOX11 and 12 are involved in the first-step cell fate transition during de novo root organogenesis in Arabidopsis. Plant Cell, 2014. 26(3): p. 1081-93 [PMID:24642937] Hu X,Xu L Transcription Factors WOX11/12 Directly Activate WOX5/7 to Promote Root Primordia Initiation and Organogenesis. Plant Physiol., 2016. 172(4): p. 2363-2373 [PMID:27784768] Sheng L, et al. Non-canonical WOX11-mediated root branching contributes to plasticity in Arabidopsis root system architecture. Development, 2017. 144(17): p. 3126-3133 [PMID:28743799] Liu J, et al. The WOX11-LBD16 Pathway Promotes Pluripotency Acquisition in Callus Cells During De Novo Shoot Regeneration in Tissue Culture. Plant Cell Physiol., 2018. 59(4): p. 734-743 [PMID:29361138] Baesso B, et al. Transcription factors PRE3 and WOX11 are involved in the formation of new lateral roots from secondary growth taproot in A. thaliana. Plant Biol (Stuttg), 2018. 20(3): p. 426-432 [PMID:29450949]