PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Traes_2DS_85FE89BC5.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 109aa MW: 12068.6 Da PI: 6.7775 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 118.1 | 8.4e-37 | 13 | 105 | 1 | 94 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgk 88 lppGfrFhPtdeel+ +yL++++++ ++++ +i++vdiyk++PwdLp+++ ++ ewyfFs+rd+ky++g r+nra+ sgyWkatg+ Traes_2DS_85FE89BC5.1 13 LPPGFRFHPTDEELILHYLRNRAAAAPCPV-PIIADVDIYKFDPWDLPSQAVYGDCEWYFFSPRDRKYPNGIRPNRAAGSGYWKATGT 99 79****************************.88***************76667789******************************** PP NAM 89 dkevls 94 dk++++ Traes_2DS_85FE89BC5.1 100 DKPIHD 105 ****87 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF101941 | 4.84E-44 | 9 | 105 | IPR003441 | NAC domain |
PROSITE profile | PS51005 | 40.914 | 13 | 109 | IPR003441 | NAC domain |
Pfam | PF02365 | 2.6E-17 | 14 | 101 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 109 aa Download sequence Send to blast |
MAMAQGQGAA TSLPPGFRFH PTDEELILHY LRNRAAAAPC PVPIIADVDI YKFDPWDLPS 60 QAVYGDCEWY FFSPRDRKYP NGIRPNRAAG SGYWKATGTD KPIHDAATG |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
3ulx_A | 3e-48 | 1 | 103 | 3 | 105 | Stress-induced transcription factor NAC1 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor of the NAC family associated with the grain protein content (GPC). Sequences of the 11 European varieties of H.vulgare tested belongs to the same haplotype while the sequence found in H.spontaneum, an ancestor of the cultivated H.vulgare which has a higher GPC, belongs to an other haplotype. {ECO:0000269|PubMed:20005003}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | KT783450 | 1e-153 | KT783450.1 Triticum aestivum NAC transcription factor 29 (NAC29) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020161118.1 | 4e-75 | protein ATAF2-like | ||||
Swissprot | D2SMN4 | 1e-52 | NAMB1_HORVS; NAC transcription factor NAM-B1 | ||||
TrEMBL | A0A1D5UXV1 | 2e-74 | A0A1D5UXV1_WHEAT; Uncharacterized protein | ||||
STRING | Traes_2DS_85FE89BC5.1 | 2e-76 | (Triticum aestivum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP1237 | 36 | 123 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G69490.1 | 3e-46 | NAC-like, activated by AP3/PI |
Publications ? help Back to Top | |||
---|---|---|---|
|