PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Traes_2DS_070CE3D50.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
|
||||||||
Family | HSF | ||||||||
Protein Properties | Length: 122aa MW: 13821.1 Da PI: 8.4983 | ||||||||
Description | HSF family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | HSF_DNA-bind | 58.6 | 1.7e-18 | 1 | 43 | 18 | 60 |
TSEESSSSSEEEES-HHHHHHHTHHHHSTT--HHHHHHHHHHT CS HSF_DNA-bind 18 liswsengnsfvvldeeefakkvLpkyFkhsnfaSFvRQLnmY 60 +isw gnsfvv+++++fa++vLp+ Fkh+nf+SFvRQLn+Y Traes_2DS_070CE3D50.1 1 VISWGPAGNSFVVWNPSTFARDVLPHNFKHNNFSSFVRQLNTY 43 69****************************************9 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF46785 | 7.62E-16 | 1 | 43 | IPR011991 | Winged helix-turn-helix DNA-binding domain |
Pfam | PF00447 | 2.3E-15 | 1 | 43 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
Gene3D | G3DSA:1.10.10.10 | 2.9E-18 | 1 | 43 | IPR011991 | Winged helix-turn-helix DNA-binding domain |
SMART | SM00415 | 8.9E-6 | 1 | 62 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0016021 | Cellular Component | integral component of membrane | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 122 aa Download sequence Send to blast |
VISWGPAGNS FVVWNPSTFA RDVLPHNFKH NNFSSFVRQL NTYVRIISLP SPLFFLSFAI 60 RRWIIHAAVL CSGDALFPLG IWHSVSDALF SFCSFWFLLL YSAQICCVYI LCTTSLAYFV 120 SG |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | HM446028 | 1e-58 | HM446028.1 Hordeum vulgare subsp. vulgare heat shock factor A3 (HsfA3) mRNA, partial cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
TrEMBL | A0A453BAC0 | 6e-81 | A0A453BAC0_AEGTS; Uncharacterized protein | ||||
STRING | Traes_2DS_070CE3D50.1 | 1e-82 | (Triticum aestivum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP27864 | 2 | 2 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G03720.1 | 1e-19 | heat shock transcription factor A3 |
Publications ? help Back to Top | |||
---|---|---|---|
|