PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Traes_2DL_E2E912AFF.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 74aa MW: 8309.32 Da PI: 8.2262 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 43 | 1.4e-13 | 31 | 74 | 1 | 45 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePw 45 lppGfrF P+d+elv++yL kkv++++ + ++ evd++ ePw Traes_2DL_E2E912AFF.1 31 LPPGFRFYPSDQELVCHYLYKKVTNERASQ-GTLVEVDLHAREPW 74 79*************************888.78***********9 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF101941 | 1.27E-14 | 27 | 74 | IPR003441 | NAC domain |
PROSITE profile | PS51005 | 18.156 | 31 | 74 | IPR003441 | NAC domain |
Pfam | PF02365 | 3.5E-8 | 32 | 74 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 74 aa Download sequence Send to blast |
LQASSCWSGG QGRRTGRPGG TMGLREIEST LPPGFRFYPS DQELVCHYLY KKVTNERASQ 60 GTLVEVDLHA REPW |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AK248480 | 3e-83 | AK248480.1 Hordeum vulgare subsp. vulgare cDNA clone: FLbaf7e16, mRNA sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_003580130.1 | 2e-31 | protein CUP-SHAPED COTYLEDON 1 | ||||
Refseq | XP_020168520.1 | 1e-31 | protein CUP-SHAPED COTYLEDON 1-like | ||||
TrEMBL | A0A1D6DH24 | 3e-30 | A0A1D6DH24_WHEAT; Uncharacterized protein | ||||
TrEMBL | A0A287IVF4 | 2e-30 | A0A287IVF4_HORVV; Uncharacterized protein | ||||
TrEMBL | A0A446MJ82 | 2e-31 | A0A446MJ82_TRITD; Uncharacterized protein | ||||
TrEMBL | M7ZGW4 | 7e-31 | M7ZGW4_TRIUA; Protein CUP-SHAPED COTYLEDON 1 | ||||
STRING | Traes_2DL_E2E912AFF.1 | 4e-49 | (Triticum aestivum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP14845 | 11 | 21 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G61430.1 | 8e-14 | NAC domain containing protein 100 |
Publications ? help Back to Top | |||
---|---|---|---|
|