PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Traes_2DL_61C443C56.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 199aa MW: 22385.9 Da PI: 6.0792 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 104.5 | 1.4e-32 | 7 | 124 | 1 | 128 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgk 88 lppGf+F P+deelv ++L++k++ +++ ++++++ ++++Pw+L+ k+ + ++wyfFs++ + +r++r +g W+ g Traes_2DL_61C443C56.1 7 LPPGFHFFPSDEELVIHFLRRKAALLPCRP-DIVPTLPQNRYDPWELNGKALQAGNQWYFFSQATQ-----SRTSR---NGCWNPIGA 85 79*************************999.89**************966667789******9754.....35555...7******** PP NAM 89 dkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128 d++v s +g++vglkktLvf g+ +++kt+Wvmhey+l Traes_2DL_61C443C56.1 86 DEAVSS-GGSHVGLKKTLVFSIGEPFQATKTNWVMHEYHL 124 *****9.999****************************98 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF101941 | 9.81E-44 | 4 | 162 | IPR003441 | NAC domain |
PROSITE profile | PS51005 | 39.798 | 7 | 163 | IPR003441 | NAC domain |
Pfam | PF02365 | 2.6E-22 | 8 | 124 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 199 aa Download sequence Send to blast |
MGGSTNLPPG FHFFPSDEEL VIHFLRRKAA LLPCRPDIVP TLPQNRYDPW ELNGKALQAG 60 NQWYFFSQAT QSRTSRNGCW NPIGADEAVS SGGSHVGLKK TLVFSIGEPF QATKTNWVMH 120 EYHLLDGNGG TSSSGSSRKR SHKKKDHPDK ECSNWVVCRV FESSYDSQVS FHEEDMELSC 180 LDEVFLSLDD YDEVSLPKN |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1ut4_A | 4e-34 | 6 | 168 | 16 | 170 | NO APICAL MERISTEM PROTEIN |
1ut4_B | 4e-34 | 6 | 168 | 16 | 170 | NO APICAL MERISTEM PROTEIN |
1ut7_A | 4e-34 | 6 | 168 | 16 | 170 | NO APICAL MERISTEM PROTEIN |
1ut7_B | 4e-34 | 6 | 168 | 16 | 170 | NO APICAL MERISTEM PROTEIN |
3swm_A | 4e-34 | 6 | 168 | 19 | 173 | NAC domain-containing protein 19 |
3swm_B | 4e-34 | 6 | 168 | 19 | 173 | NAC domain-containing protein 19 |
3swm_C | 4e-34 | 6 | 168 | 19 | 173 | NAC domain-containing protein 19 |
3swm_D | 4e-34 | 6 | 168 | 19 | 173 | NAC domain-containing protein 19 |
3swp_A | 4e-34 | 6 | 168 | 19 | 173 | NAC domain-containing protein 19 |
3swp_B | 4e-34 | 6 | 168 | 19 | 173 | NAC domain-containing protein 19 |
3swp_C | 4e-34 | 6 | 168 | 19 | 173 | NAC domain-containing protein 19 |
3swp_D | 4e-34 | 6 | 168 | 19 | 173 | NAC domain-containing protein 19 |
4dul_A | 4e-34 | 6 | 168 | 16 | 170 | NAC domain-containing protein 19 |
4dul_B | 4e-34 | 6 | 168 | 16 | 170 | NAC domain-containing protein 19 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor that influences tracheary elements and xylem development by negatively regulating secondary cell wall fiber synthesis and programmed cell death. {ECO:0000269|PubMed:18069942, ECO:0000269|PubMed:20458494}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | FR819767 | 0.0 | FR819767.1 Hordeum vulgare subsp. vulgare mRNA for NAC transcription factor (NAC026 gene). |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020165263.1 | 1e-149 | NAC domain-containing protein 104 isoform X1 | ||||
Swissprot | Q8GWK6 | 3e-61 | NC104_ARATH; NAC domain-containing protein 104 | ||||
TrEMBL | A0A453C0T5 | 1e-148 | A0A453C0T5_AEGTS; Uncharacterized protein | ||||
STRING | Traes_2BL_F4302657F.2 | 1e-149 | (Triticum aestivum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP3667 | 36 | 79 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G64530.1 | 4e-62 | xylem NAC domain 1 |
Publications ? help Back to Top | |||
---|---|---|---|
|