PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Traes_2AS_7AAACC26B.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 193aa MW: 21887 Da PI: 9.2899 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 171.1 | 3.4e-53 | 19 | 149 | 1 | 129 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgk 88 lppGfrFhPtdee+v++yL++k+ ++ +++ vi++vd++k+ePwdLp k+k +ekewyfF+++d+ky+tg+r+nrat++gyWkatgk Traes_2AS_7AAACC26B.1 19 LPPGFRFHPTDEEVVTHYLTPKAVNNAFSC-LVIADVDLNKTEPWDLPGKAKMGEKEWYFFVHKDRKYPTGTRTNRATEKGYWKATGK 105 79**************************99.78***************99999*********************************** PP NAM 89 dkevlsk...kgelvglkktLvfykgrapkgektdWvmheyrle 129 dkev++ + lvg+kktLvfy+grap+g kt vmheyrle Traes_2AS_7AAACC26B.1 106 DKEVFRGkgrDAVLVGMKKTLVFYTGRAPRGDKTPYVMHEYRLE 149 *****984444445****************************85 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF101941 | 1.44E-60 | 15 | 172 | IPR003441 | NAC domain |
PROSITE profile | PS51005 | 56.614 | 19 | 172 | IPR003441 | NAC domain |
Pfam | PF02365 | 8.6E-28 | 20 | 148 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 193 aa Download sequence Send to blast |
MSDVTAVMDL EVEEPRLSLP PGFRFHPTDE EVVTHYLTPK AVNNAFSCLV IADVDLNKTE 60 PWDLPGKAKM GEKEWYFFVH KDRKYPTGTR TNRATEKGYW KATGKDKEVF RGKGRDAVLV 120 GMKKTLVFYT GRAPRGDKTP YVMHEYRLEG QLPHRLPRSA RNDWAVCRVF DKDLAAKNAP 180 PQTASAAVGV MED |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1ut4_A | 2e-54 | 8 | 177 | 4 | 170 | NO APICAL MERISTEM PROTEIN |
1ut4_B | 2e-54 | 8 | 177 | 4 | 170 | NO APICAL MERISTEM PROTEIN |
1ut7_A | 2e-54 | 8 | 177 | 4 | 170 | NO APICAL MERISTEM PROTEIN |
1ut7_B | 2e-54 | 8 | 177 | 4 | 170 | NO APICAL MERISTEM PROTEIN |
3swm_A | 2e-54 | 8 | 177 | 7 | 173 | NAC domain-containing protein 19 |
3swm_B | 2e-54 | 8 | 177 | 7 | 173 | NAC domain-containing protein 19 |
3swm_C | 2e-54 | 8 | 177 | 7 | 173 | NAC domain-containing protein 19 |
3swm_D | 2e-54 | 8 | 177 | 7 | 173 | NAC domain-containing protein 19 |
3swp_A | 2e-54 | 8 | 177 | 7 | 173 | NAC domain-containing protein 19 |
3swp_B | 2e-54 | 8 | 177 | 7 | 173 | NAC domain-containing protein 19 |
3swp_C | 2e-54 | 8 | 177 | 7 | 173 | NAC domain-containing protein 19 |
3swp_D | 2e-54 | 8 | 177 | 7 | 173 | NAC domain-containing protein 19 |
4dul_A | 2e-54 | 8 | 177 | 4 | 170 | NAC domain-containing protein 19 |
4dul_B | 2e-54 | 8 | 177 | 4 | 170 | NAC domain-containing protein 19 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Binds to the promoter regions of genes involved in chlorophyll catabolic processes, such as NYC1, SGR1, SGR2 and PAO. {ECO:0000269|PubMed:27021284}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Repressed by the microRNA miR164. {ECO:0000269|PubMed:15294871, ECO:0000269|PubMed:17098808}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AK364498 | 0.0 | AK364498.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2025P03. | |||
GenBank | AK364649 | 0.0 | AK364649.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2027E04. | |||
GenBank | AK367098 | 0.0 | AK367098.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2051F14. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020161331.1 | 1e-139 | NAC domain-containing protein 92-like | ||||
Swissprot | Q9FLJ2 | 3e-80 | NC100_ARATH; NAC domain-containing protein 100 | ||||
TrEMBL | A0A3B6ASJ7 | 1e-141 | A0A3B6ASJ7_WHEAT; Uncharacterized protein | ||||
TrEMBL | A0A446KLS4 | 1e-141 | A0A446KLS4_TRITD; Uncharacterized protein | ||||
STRING | Traes_2AS_7AAACC26B.1 | 1e-142 | (Triticum aestivum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP1862 | 38 | 104 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G61430.1 | 1e-82 | NAC domain containing protein 100 |
Publications ? help Back to Top | |||
---|---|---|---|
|