PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Traes_2AS_409CAEDB6.1

Organism

Triticum aestivum

Taxonomic ID

4565

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum

Family

EIL

Protein Properties

Length: 121aa MW: 13764.9 Da PI: 11.5675

Description

EIL family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Traes_2AS_409CAEDB6.1	genome	IWGSC	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	EIN3	166	4.2e-51	1	118	7	118
XXXXXXXXXXXXXXXXX..XXXXX.XXXXXXX......XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX CS EIN3 7 mwkdqmllkrlkerkkqlledkeaatgakksn......ksneqarrkkmsraQDgiLkYMlkemevcnaqGfvYgiipekgkpvegas 88 mw+d+m+lkrlke ++++ ++ + + a+k + + +qarrkkmsraQDgiLkYMlk+me+c aqGfvYgi+pe+gkpv gas Traes_2AS_409CAEDB6.1 1 MWRDRMRLKRLKELQQRQSQRPDGGAAASKGRprrpasQQDQQARRKKMSRAQDGILKYMLKMMEACSAQGFVYGIVPENGKPVGGAS 88 9**********9999775555545555544999999999******************************************* PP XXXXXXXXXXXXXXXXXXXXXXXXXXXXXX CS EIN3 89 dsLraWWkekvefdrngpaaiskyqaknli 118 d+LraWWkekv+fdrn+paai+k+ ++n++ Traes_2AS_409CAEDB6.1 89 DNLRAWWKEKVRFDRNAPAAIAKHRSDNAA 118 **********************888865 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Pfam	PF04873	6.1E-50	1	118	No hit	No description

Sequence ? help Back to Top
Protein Sequence Length: 121 aa Download sequence Send to blast
MWRDRMRLKR LKELQQRQSQ RPDGGAAASK GRPRRPASQQ DQQARRKKMS RAQDGILKYM 60 LKMMEACSAQ GFVYGIVPEN GKPVGGASDN LRAWWKEKVR FDRNAPAAIA KHRSDNAAPL 120 C

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor acting as a positive regulator in the ethylene response pathway (PubMed:16786297, PubMed:28829777, PubMed:27701783, PubMed:25995326). Required for the inhibition of root growth by ethylene in etiolated seedlings (PubMed:25995326, PubMed:28829777). Functions upstream of the auxin biosynthetic gene YUCCA8 and directly activates its expression (PubMed:28829777). Functions downstream of the ethylene signaling factor EIN2 in disease resistance against the rice blast fungus (Magnaporthe oryzae) (PubMed:27701783). Binds directly to the promoters of the NADPH oxidases RBOHA and RBOHB, and the jasmonate biosynthetic gene OPR4 to activate their expression during fungal infection (PubMed:27701783). May enhance disease resistance by facilitating reactive oxygen species (ROS) generation and jasmonate biosynthesis with subsequent phytoalexin accumulation during Magnaporthe oryzae infection (PubMed:27701783). Acts as negative regulator of salt tolerance (PubMed:25995326). During salt stress, activates the cation transporter HKT1, which mediates increased sodium uptake in roots, and contributes to sodium accumulation and salt toxicity (PubMed:25995326). Binds directly to the DNA sequence 5'-TGTTACAAATACC-3' in the promoter of the GA20OX2 gene to activate its expression at the transcriptional level during ethylene signaling (PubMed:30002253). Possesses transactivation activity in protoplasts (PubMed:25995326). {ECO:0000269\|PubMed:16786297, ECO:0000269\|PubMed:25995326, ECO:0000269\|PubMed:27701783, ECO:0000269\|PubMed:28829777, ECO:0000269\|PubMed:30002253}.
UniProt	Transcription factor acting as a positive regulator in the ethylene response pathway (PubMed:19798512). Involved in wound signaling by binding specifically to the DNA sequence 5'-ATGTACCT-3' found in the promoter of some wound-inducible genes (PubMed:19798512). Binds directly to the DNA sequence 5'-TGTTACAAATACC-3' in the promoter of the GA20OX2 gene to activate its expression at the transcriptional level during ethylene signaling (PubMed:30002253). {ECO:0000269\|PubMed:19798512, ECO:0000269\|PubMed:30002253}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Induced by infection with the fungal pathogen Magnaporthe oryzae. {ECO:0000269\|PubMed:27701783}.
UniProt	INDUCTION: Induced by wounding. {ECO:0000269\|PubMed:19798512}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AB074971	3e-81	AB074971.2 Oryza sativa Japonica Group OsEIL1 mRNA for ethylene-insensitive-3-like protein, complete cds.
GenBank	AC118674	3e-81	AC118674.3 Genomic sequence for Oryza sativa, Nipponbare strain, clone OSJNBb0093J20, from chromosome 3, complete sequence.
GenBank	AC137070	3e-81	AC137070.2 Genomic sequence for Oryza sativa, Nipponbare strain, clone OSJNBa0035J18, from chromsome 3, complete sequence.
GenBank	AK060826	3e-81	AK060826.1 Oryza sativa Japonica Group cDNA clone:001-034-B06, full insert sequence.
GenBank	AK068429	3e-81	AK068429.1 Oryza sativa Japonica Group cDNA clone:J013154I08, full insert sequence.
GenBank	AK072465	3e-81	AK072465.1 Oryza sativa Japonica Group cDNA clone:J023116C13, full insert sequence.
GenBank	AK098905	3e-81	AK098905.1 Oryza sativa Japonica Group cDNA clone:J013002D08, full insert sequence.
GenBank	AK098987	3e-81	AK098987.1 Oryza sativa Japonica Group cDNA clone:J013095D20, full insert sequence.
GenBank	AK101076	3e-81	AK101076.1 Oryza sativa Japonica Group cDNA clone:J033024C06, full insert sequence.
GenBank	AK103227	3e-81	AK103227.1 Oryza sativa Japonica Group cDNA clone:J033123C05, full insert sequence.
GenBank	AK241453	3e-81	AK241453.1 Oryza sativa Japonica Group cDNA, clone: J065163N20, full insert sequence.
GenBank	AP014959	3e-81	AP014959.1 Oryza sativa Japonica Group DNA, chromosome 3, cultivar: Nipponbare, complete sequence.
GenBank	CP012611	3e-81	CP012611.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 3 sequence.
GenBank	DQ153245	3e-81	DQ153245.1 Oryza sativa (japonica cultivar-group) EIN3-like protein 1 (EIL1) mRNA, complete cds.
GenBank	FP095463	3e-81	FP095463.1 Phyllostachys edulis cDNA clone: bphylf050m22, full insert sequence.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_020153937.1	8e-78	ETHYLENE INSENSITIVE 3-like 1 protein
Swissprot	Q10M41	6e-53	EIL1A_ORYSJ; Protein ETHYLENE-INSENSITIVE 3-like 1a
Swissprot	Q8W3M0	5e-53	EIL1B_ORYSJ; Protein ETHYLENE-INSENSITIVE 3-like 1b
TrEMBL	A0A446KLM4	2e-78	A0A446KLM4_TRITD; Uncharacterized protein
STRING	Traes_2AS_409CAEDB6.1	2e-83	(Triticum aestivum)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP3720	37	79

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT2G27050.1	2e-48	ETHYLENE-INSENSITIVE3-like 1

Publications ? help Back to Top
Kikuchi S, et al. Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice. Science, 2003. 301(5631): p. 376-9 [PMID:12869764] Brenchley R, et al. Analysis of the bread wheat genome using whole-genome shotgun sequencing. Nature, 2012. 491(7426): p. 705-10 [PMID:23192148] Yang C, et al. MAOHUZI6/ETHYLENE INSENSITIVE3-LIKE1 and ETHYLENE INSENSITIVE3-LIKE2 Regulate Ethylene Response of Roots and Coleoptiles and Negatively Affect Salt Tolerance in Rice. Plant Physiol., 2015. 169(1): p. 148-65 [PMID:25995326] Yang C, et al. Activation of ethylene signaling pathways enhances disease resistance by regulating ROS and phytoalexin production in rice. Plant J., 2017. 89(2): p. 338-353 [PMID:27701783] Qin H, et al. The activation of OsEIL1 on YUC8 transcription and auxin biosynthesis is required for ethylene-inhibited root elongation in rice early seedling development. PLoS Genet., 2017. 13(8): p. e1006955 [PMID:28829777] Kuroha T, et al. Ethylene-gibberellin signaling underlies adaptation of rice to periodic flooding. Science, 2018. 361(6398): p. 181-186 [PMID:30002253]