PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Traes_1BL_0E29B6971.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
|
||||||||
Family | HB-other | ||||||||
Protein Properties | Length: 45aa MW: 5366.12 Da PI: 9.9225 | ||||||||
Description | HB-other family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Homeobox | 31.7 | 2.5e-10 | 2 | 33 | 23 | 54 |
SS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS Homeobox 23 rypsaeereeLAkklgLterqVkvWFqNrRak 54 ryps ++ LA+++gL+ +qV++WF N R + Traes_1BL_0E29B6971.1 2 RYPSDVDKHILARQTGLSRSQVSNWFINARVR 33 8*****************************98 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50071 | 11.774 | 1 | 37 | IPR001356 | Homeobox domain |
CDD | cd00086 | 5.00E-9 | 1 | 38 | No hit | No description |
SuperFamily | SSF46689 | 6.84E-14 | 2 | 43 | IPR009057 | Homeodomain-like |
Pfam | PF05920 | 4.0E-14 | 3 | 33 | IPR008422 | Homeobox KN domain |
Gene3D | G3DSA:1.10.10.60 | 7.5E-19 | 3 | 43 | IPR009057 | Homeodomain-like |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 45 aa Download sequence Send to blast |
SRYPSDVDKH ILARQTGLSR SQVSNWFINA RVRLWKPMVE EMYAE |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Plays a major role in ovule patterning and in determination of integument identity via its interaction with MADS-box factors. Formation of complex with AG-SEP dimers negatively regulates the carpel identity process and favors the maintenance of ovule identity. BEL1-STM complex maintains the indeterminacy of the inflorescence meristem. Required, with SPL, for cytokinin-induced PIN1 expression in ovules (PubMed:22786869). {ECO:0000269|PubMed:12244239, ECO:0000269|PubMed:17693535, ECO:0000269|PubMed:22786869}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AK358409 | 2e-61 | AK358409.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv1076A02. | |||
GenBank | AK359112 | 2e-61 | AK359112.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv1089L06. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_025793881.1 | 2e-24 | homeobox protein BEL1 homolog | ||||
Swissprot | Q38897 | 1e-23 | BEL1_ARATH; Homeobox protein BEL1 homolog | ||||
TrEMBL | M0YWS5 | 6e-26 | M0YWS5_HORVV; Uncharacterized protein | ||||
STRING | MLOC_73862.2 | 1e-26 | (Hordeum vulgare) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G41410.1 | 6e-26 | TALE family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|