PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_1BL_0E29B6971.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family HB-other
Protein Properties Length: 45aa    MW: 5366.12 Da    PI: 9.9225
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_1BL_0E29B6971.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox31.72.5e-102332354
                           SS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
               Homeobox 23 rypsaeereeLAkklgLterqVkvWFqNrRak 54
                           ryps  ++  LA+++gL+ +qV++WF N R +
  Traes_1BL_0E29B6971.1  2 RYPSDVDKHILARQTGLSRSQVSNWFINARVR 33
                           8*****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007111.774137IPR001356Homeobox domain
CDDcd000865.00E-9138No hitNo description
SuperFamilySSF466896.84E-14243IPR009057Homeodomain-like
PfamPF059204.0E-14333IPR008422Homeobox KN domain
Gene3DG3DSA:1.10.10.607.5E-19343IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 45 aa     Download sequence    Send to blast
SRYPSDVDKH ILARQTGLSR SQVSNWFINA RVRLWKPMVE EMYAE
Functional Description ? help Back to Top
Source Description
UniProtPlays a major role in ovule patterning and in determination of integument identity via its interaction with MADS-box factors. Formation of complex with AG-SEP dimers negatively regulates the carpel identity process and favors the maintenance of ovule identity. BEL1-STM complex maintains the indeterminacy of the inflorescence meristem. Required, with SPL, for cytokinin-induced PIN1 expression in ovules (PubMed:22786869). {ECO:0000269|PubMed:12244239, ECO:0000269|PubMed:17693535, ECO:0000269|PubMed:22786869}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3584092e-61AK358409.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv1076A02.
GenBankAK3591122e-61AK359112.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv1089L06.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025793881.12e-24homeobox protein BEL1 homolog
SwissprotQ388971e-23BEL1_ARATH; Homeobox protein BEL1 homolog
TrEMBLM0YWS56e-26M0YWS5_HORVV; Uncharacterized protein
STRINGMLOC_73862.21e-26(Hordeum vulgare)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G41410.16e-26TALE family protein
Publications ? help Back to Top
  1. Yamada T,Sasaki Y,Hashimoto K,Nakajima K,Gasser CS
    CORONA, PHABULOSA and PHAVOLUTA collaborate with BELL1 to confine WUSCHEL expression to the nucellus in Arabidopsis ovules.
    Development, 2016. 143(3): p. 422-6
    [PMID:26700684]
  2. Lozano-Sotomayor P, et al.
    Altered expression of the bZIP transcription factor DRINK ME affects growth and reproductive development in Arabidopsis thaliana.
    Plant J., 2016. 88(3): p. 437-451
    [PMID:27402171]