PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Traes_1AL_F64E07A92.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
|
||||||||
Family | WRKY | ||||||||
Protein Properties | Length: 168aa MW: 18766.2 Da PI: 10.0299 | ||||||||
Description | WRKY family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | WRKY | 105.2 | 3.5e-33 | 26 | 84 | 1 | 59 |
---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS WRKY 1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 ldDgy+WrKYGqK vk+s fprsYYrCt a+C vkk vers++dp++v++tYeg+H h+ Traes_1AL_F64E07A92.1 26 LDDGYRWRKYGQKAVKNSSFPRSYYRCTAAQCGVKKLVERSQQDPSTVVTTYEGRHAHP 84 59********************************************************8 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:2.20.25.80 | 6.0E-33 | 13 | 86 | IPR003657 | WRKY domain |
SuperFamily | SSF118290 | 2.35E-28 | 20 | 86 | IPR003657 | WRKY domain |
PROSITE profile | PS50811 | 30.251 | 21 | 86 | IPR003657 | WRKY domain |
SMART | SM00774 | 5.2E-37 | 26 | 85 | IPR003657 | WRKY domain |
Pfam | PF03106 | 3.6E-26 | 27 | 84 | IPR003657 | WRKY domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 168 aa Download sequence Send to blast |
MKEGKREKKP RGSRVAFATK SAVDHLDDGY RWRKYGQKAV KNSSFPRSYY RCTAAQCGVK 60 KLVERSQQDP STVVTTYEGR HAHPSPIATH RGSRMLMATG VDTVYSLDVL QHQHHGFFPA 120 GTDVYGRMYA LPSTDASVVA HRSSEYGGMQ VHAGVLPDAV MSYEHVHR |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1wj2_A | 6e-27 | 19 | 86 | 10 | 77 | Probable WRKY transcription factor 4 |
2lex_A | 6e-27 | 19 | 86 | 10 | 77 | Probable WRKY transcription factor 4 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020180591.1 | 1e-108 | probable WRKY transcription factor 28 | ||||
Swissprot | O22900 | 5e-38 | WRK23_ARATH; WRKY transcription factor 23 | ||||
TrEMBL | M7YVL6 | 1e-120 | M7YVL6_TRIUA; Putative WRKY transcription factor 23 | ||||
STRING | Traes_1AL_F64E07A92.1 | 1e-122 | (Triticum aestivum) | ||||
STRING | TRIUR3_10994-P1 | 1e-121 | (Triticum urartu) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP623 | 37 | 173 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G47260.1 | 2e-40 | WRKY DNA-binding protein 23 |
Publications ? help Back to Top | |||
---|---|---|---|
|