PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

TRAES3BF020200120CFD_t1

Common Name

TRAES_3BF020200120CFD_c1

Organism

Triticum aestivum

Taxonomic ID

4565

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum

Family

MYB_related

Protein Properties

Length: 76aa MW: 8862.01 Da PI: 7.806

Description

MYB_related family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
TRAES3BF020200120CFD_t1	genome	IWGSC	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	30.8	7e-10	31	70	4	45
S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS Myb_DNA-binding 4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 +T+ E++l + +++ G++ W++Ia +++ gRt++++ +w TRAES3BF020200120CFD_t1 31 FTEAEEDLVFRMHRLVGNR-WELIAGRIP-GRTAEEVEMFWA 70 9****************.*****.*****99886 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SMART	SM00717	1.8E-7	27	75	IPR001005	SANT/Myb domain
SuperFamily	SSF46689	5.23E-9	30	72	IPR009057	Homeodomain-like
PROSITE profile	PS50090	6.655	31	73	IPR017877	Myb-like domain
CDD	cd00167	1.93E-7	31	69	No hit	No description
Pfam	PF00249	6.1E-9	31	70	IPR001005	SANT/Myb domain
Gene3D	G3DSA:1.10.10.60	4.6E-12	31	71	IPR009057	Homeodomain-like

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0045892	Biological Process	negative regulation of transcription, DNA-templated
GO:1900033	Biological Process	negative regulation of trichome patterning
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 76 aa Download sequence Send to blast
MSSESLGKNS KIMGGRERKE VNSTAKHFVD FTEAEEDLVF RMHRLVGNRW ELIAGRIPGR 60 TAEEVEMFWA KRHQDQ

Functional Description ? help Back to Top
Source	Description
UniProt	MYB-type transcription factor involved in trichome cell specification. Acts as a negative regulator of trichome patterning and formation. May function by suppressing the expression of GL3. {ECO:0000269\|PubMed:22168948}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	JF951933	1e-121	JF951933.1 Aegilops speltoides clone TaMYB50 MYB-related protein mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_020165156.1	3e-49	MYB-like transcription factor TCL2
Refseq	XP_020165157.1	3e-49	MYB-like transcription factor TCL2
Refseq	XP_020172618.1	3e-49	MYB-like transcription factor TCL2
Refseq	XP_020172619.1	3e-49	MYB-like transcription factor TCL2
Swissprot	B3H4X8	4e-19	TCL2_ARATH; MYB-like transcription factor TCL2
TrEMBL	A0A077RXW4	8e-49	A0A077RXW4_WHEAT; Uncharacterized protein
TrEMBL	G9DR96	8e-49	G9DR96_AEGSP; MYB-related protein
TrEMBL	M7YVH5	8e-49	M7YVH5_TRIUA; Transcription factor TRY
STRING	TRIUR3_10842-P1	1e-49	(Triticum urartu)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP5275	31	57

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT2G30424.1	2e-21	MYB_related family protein

Publications ? help Back to Top
Brenchley R, et al. Analysis of the bread wheat genome using whole-genome shotgun sequencing. Nature, 2012. 491(7426): p. 705-10 [PMID:23192148] Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Huang M,Hu Y,Liu X,Li Y,Hou X Arabidopsis LEAFY COTYLEDON1 controls cell fate determination during post-embryonic development. Front Plant Sci, 2015. 6: p. 955 [PMID:26579186]