PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | TRAES3BF004600010CFD_t1 | ||||||||
Common Name | TRAES_3BF004600010CFD_c1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 121aa MW: 13510.2 Da PI: 6.9328 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 118.2 | 3.9e-37 | 1 | 78 | 17 | 94 |
NF-YB 17 mkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrele 94 mk vlP +ak+sk+ake++qec++efi+fvt+eas++c+re+rkt+ngdd+++a++tlG+++y+ +++ yl++yre e TRAES3BF004600010CFD_t1 1 MKDVLPPEAKVSKHAKEVIQECATEFIGFVTGEASERCRRERRKTVNGDDICHAMTTLGLDNYAGAMRRYLQRYREGE 78 89*************************************************************************976 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.20.10 | 5.2E-33 | 1 | 81 | IPR009072 | Histone-fold |
SuperFamily | SSF47113 | 1.84E-25 | 1 | 82 | IPR009072 | Histone-fold |
Pfam | PF00808 | 3.6E-17 | 1 | 55 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
PRINTS | PR00615 | 1.7E-14 | 19 | 37 | No hit | No description |
PRINTS | PR00615 | 1.7E-14 | 38 | 56 | No hit | No description |
PRINTS | PR00615 | 1.7E-14 | 57 | 75 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 121 aa Download sequence Send to blast |
MKDVLPPEAK VSKHAKEVIQ ECATEFIGFV TGEASERCRR ERRKTVNGDD ICHAMTTLGL 60 DNYAGAMRRY LQRYREGEEL AAVLNNHSRS PAPPAPGDGM IQIDVWGELS NSRGNEKHGR 120 D |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
4g91_B | 7e-31 | 1 | 76 | 17 | 92 | Transcription factor HapC (Eurofung) |
4g92_B | 7e-31 | 1 | 76 | 17 | 92 | Transcription factor HapC (Eurofung) |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | HG670306 | 0.0 | HG670306.1 Triticum aestivum chromosome 3B, genomic scaffold, cultivar Chinese Spring. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020196190.1 | 5e-83 | transcriptional activator hap3-like | ||||
Swissprot | O04027 | 1e-33 | NFYB4_ARATH; Nuclear transcription factor Y subunit B-4 | ||||
TrEMBL | A0A077RZV0 | 6e-86 | A0A077RZV0_WHEAT; Uncharacterized protein | ||||
STRING | Traes_3B_DBC77FFF1.1 | 2e-85 | (Triticum aestivum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP2917 | 38 | 87 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G09030.1 | 5e-36 | nuclear factor Y, subunit B4 |
Publications ? help Back to Top | |||
---|---|---|---|
|