PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Sevir.9G024700.1.p | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
|
||||||||
Family | GATA | ||||||||
Protein Properties | Length: 153aa MW: 16684.1 Da PI: 10.5126 | ||||||||
Description | GATA family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | GATA | 56.8 | 3.1e-18 | 27 | 61 | 1 | 35 |
GATA 1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 C+ C+ttkTplWR gp g+ +LCnaCG++yrkk++ Sevir.9G024700.1.p 27 CTECHTTKTPLWRGGPCGPMSLCNACGIRYRKKRR 61 ********************************986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF57716 | 8.08E-14 | 19 | 60 | No hit | No description |
SMART | SM00401 | 4.8E-15 | 21 | 73 | IPR000679 | Zinc finger, GATA-type |
PROSITE profile | PS50114 | 12.479 | 21 | 57 | IPR000679 | Zinc finger, GATA-type |
Gene3D | G3DSA:3.30.50.10 | 2.0E-14 | 25 | 61 | IPR013088 | Zinc finger, NHR/GATA-type |
CDD | cd00202 | 5.84E-14 | 26 | 61 | No hit | No description |
Pfam | PF00320 | 5.2E-16 | 27 | 61 | IPR000679 | Zinc finger, GATA-type |
PROSITE pattern | PS00344 | 0 | 27 | 52 | IPR000679 | Zinc finger, GATA-type |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0008270 | Molecular Function | zinc ion binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 153 aa Download sequence Send to blast |
MDSSVEKQGS GSPDPDERPA AGEPKACTEC HTTKTPLWRG GPCGPMSLCN ACGIRYRKKR 60 REAMGLDANK AAGGEQQQQQ QRKKKAAAAA ASKREREKGA EADEVTVELR TVGFGKEVVL 120 KQRRRMRRRR RLGEEERAAI LLMALSSGVV YA* |
Nucleic Localization Signal ? help Back to Top | |||
---|---|---|---|
No. | Start | End | Sequence |
1 | 121 | 127 | QRRRMRR |
2 | 123 | 128 | RRMRRR |
3 | 123 | 130 | RRMRRRRR |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Sevir.9G024700.1.p |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | KJ728013 | 1e-119 | KJ728013.1 Zea mays clone pUT6148 C2C2-GATA transcription factor (GATA18) mRNA, partial cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_004981176.1 | 1e-106 | GATA transcription factor 16 isoform X1 | ||||
TrEMBL | K4AG85 | 1e-105 | K4AG85_SETIT; Uncharacterized protein | ||||
STRING | Si037892m | 1e-106 | (Setaria italica) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP2418 | 38 | 92 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G26930.1 | 7e-18 | GATA transcription factor 23 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Sevir.9G024700.1.p |