PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Home  TFext  BLAST  Prediction  Download  Help  About  Links  PlantRegMap
(e.g., LFY)
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PGSC0003DMP400059841
Common NameLOC102600815
Organism
Solanum tuberosum
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family bZIP
Protein Properties Length: 145aa    MW: 16633.6 Da    PI: 6.5455
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PGSC0003DMP400059841genomePGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_135.91.6e-112381563
                          CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                bZIP_1  5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63
                          ++ +r+++NRe+ArrsR++K++ +eeL     +L+++ +  ++++e+   +  +l++e+
  PGSC0003DMP400059841 23 RKRKRMESNRESARRSRKKKQQHLEELMSQLTQLQNQSTIWREKIESVGRNFHTLDAEN 81
                          67899****************************************99988888887776 PP
Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003385.4E-171983IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1702.1E-101976No hitNo description
PROSITE profilePS5021710.8982184IPR004827Basic-leucine zipper domain
PfamPF001701.3E-82379IPR004827Basic-leucine zipper domain
SuperFamilySSF579596.25E-112377No hitNo description
CDDcd147021.02E-142475No hitNo description
PROSITE patternPS0003602641IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 145 aa     Download sequence    Send to blast
MASTQQPASS GSDGQRYATN DERKRKRMES NRESARRSRK KKQQHLEELM SQLTQLQNQS  60
TIWREKIESV GRNFHTLDAE NNVLRAQMAE LTERLDSLNS LTRFWADANG LAVDIPEIPD  120
TLLEPWQLPY PIQPITASAD MFQF*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
12441RKRMESNRESARRSRKKK
23541RRSRKKK
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator that binds DNA to the C-box-like motif (5'-TGCTGACGTCA-3'), ABRE elements, G-box-like motif (5'-CCACGTGGCC-3'), DOF (5'-AAAG-3'), I-box (5'-GATAA-3'), BS1 (5'-AGCGGG-3'), MY3 (5'-CGACG-3'), 5'-CAGTGCGC-3' and 5'-ACTCAT-3' sequence in target gene promoters (PubMed:15047879, PubMed:16810321, PubMed:19531597, PubMed:21278122, PubMed:25108460). DNA-binding and subsequent transcription activation is triggered by heterodimerization with other bZIP proteins (e.g. BZIP1, BZIP10 and BZIP25) (PubMed:16810321, PubMed:19531597, PubMed:21278122). Promotes POX1/PRODH1 expression in response to hypoosmolarity stress (PubMed:15047879, PubMed:16810321). Transcriptional activator of seed maturation (MAT) genes (e.g. AT2S2), including seed storage protein (SSP) and late embryogenesis abundant (LEA) genes (PubMed:19531597). Activated by low energy stress both by transcriptional and post-transcriptional mechanisms. Promotes dark-induced senescence and participates in the transcriptional reprogramming of amino acid metabolism during the dark-induced starvation response, especially when heterodimerized with BZIP1, by triggering accumulation of sepcific proteins including ASN1 and POX1/PRODH1 (PubMed:21278122). {ECO:0000269|PubMed:15047879, ECO:0000269|PubMed:16810321, ECO:0000269|PubMed:19531597, ECO:0000269|PubMed:21278122, ECO:0000269|PubMed:25108460}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPGSC0003DMP400059841
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By hypoosmolarity (PubMed:15047879, PubMed:16810321). Accumulates during dark-induced starvation (PubMed:21278122). {ECO:0000269|PubMed:15047879, ECO:0000269|PubMed:16810321, ECO:0000269|PubMed:21278122}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2389180.0AC238918.11 Solanum lycopersicum strain Heinz 1706 chromosome 1 clone hba-210f9 map 1, complete sequence.
GenBankAC2459950.0AC245995.3 Solanum lycopersicum strain Heinz 1706 chromosome 1 clone sle-57d7 map 1, complete sequence.
GenBankAF1766410.0AF176641.1 Lycopersicon esculentum bZIP DNA-binding protein mRNA, complete cds.
GenBankHG9755130.0HG975513.1 Solanum lycopersicum chromosome ch01, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006349190.11e-103PREDICTED: bZIP transcription factor 53-like
SwissprotQ9LZP83e-43BZP53_ARATH; bZIP transcription factor 53
TrEMBLM1DFD31e-102M1DFD3_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000881661e-103(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA28102351
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G62420.11e-45basic region/leucine zipper motif 53
Publications ? help Back to Top
  1. Xu X, et al.
    Genome sequence and analysis of the tuber crop potato.
    Nature, 2011. 475(7355): p. 189-95
    [PMID:21743474]
  2. Restovic F,Espinoza-Corral R,Gómez I,Vicente-Carbajosa J,Jordana X
    An active Mitochondrial Complex II Present in Mature Seeds Contains an Embryo-Specific Iron-Sulfur Subunit Regulated by ABA and bZIP53 and Is Involved in Germination and Seedling Establishment.
    Front Plant Sci, 2017. 8: p. 277
    [PMID:28293251]
  3. Ezer D, et al.
    The G-Box Transcriptional Regulatory Code in Arabidopsis.
    Plant Physiol., 2017. 175(2): p. 628-640
    [PMID:28864470]
  4. Jain P, et al.
    A-ZIP53, a dominant negative reveals the molecular mechanism of heterodimerization between bZIP53, bZIP10 and bZIP25 involved in Arabidopsis seed maturation.
    Sci Rep, 2017. 7(1): p. 14343
    [PMID:29084982]
  5. Pedrotti L, et al.
    Snf1-RELATED KINASE1-Controlled C/S1-bZIP Signaling Activates Alternative Mitochondrial Metabolic Pathways to Ensure Plant Survival in Extended Darkness.
    Plant Cell, 2018. 30(2): p. 495-509
    [PMID:29348240]