PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | PGSC0003DMP400055799 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 214aa MW: 24793.7 Da PI: 9.4175 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 178.6 | 1.6e-55 | 16 | 142 | 1 | 129 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkd 89 lppGfrFhPtdeel+++yL +kv ++++ + +i +vd++kvePwdLp k+k +ekewyfF+ rdkky+tg r+nrat++gyWkatgkd PGSC0003DMP400055799 16 LPPGFRFHPTDEELITHYLSNKVVDTNFIA-IAIGDVDLNKVEPWDLPWKAKMGEKEWYFFCVRDKKYPTGLRTNRATAAGYWKATGKD 103 79************************9777.78***************888999*********************************** PP NAM 90 kevlskkgelvglkktLvfykgrapkgektdWvmheyrle 129 +e+++ +++lvg+kktLvfykgrapkgekt+Wv+he+rle PGSC0003DMP400055799 104 REIYR-GKSLVGMKKTLVFYKGRAPKGEKTNWVIHEFRLE 142 *****.999****************************985 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF101941 | 8.24E-60 | 13 | 161 | IPR003441 | NAC domain |
PROSITE profile | PS51005 | 53.157 | 16 | 164 | IPR003441 | NAC domain |
Pfam | PF02365 | 2.5E-28 | 17 | 141 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 214 aa Download sequence Send to blast |
MENYSGVVKD DDQMELPPGF RFHPTDEELI THYLSNKVVD TNFIAIAIGD VDLNKVEPWD 60 LPWKAKMGEK EWYFFCVRDK KYPTGLRTNR ATAAGYWKAT GKDREIYRGK SLVGMKKTLV 120 FYKGRAPKGE KTNWVIHEFR LEGKLSLHNL PKTAKVHIIR IEATSLSRNE VEVRSAYILF 180 STDSTYEITF DMFVVVVFSI KILFFWVFCR MNG* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1ut4_A | 7e-50 | 13 | 141 | 14 | 142 | NO APICAL MERISTEM PROTEIN |
1ut4_B | 7e-50 | 13 | 141 | 14 | 142 | NO APICAL MERISTEM PROTEIN |
1ut7_A | 7e-50 | 13 | 141 | 14 | 142 | NO APICAL MERISTEM PROTEIN |
1ut7_B | 7e-50 | 13 | 141 | 14 | 142 | NO APICAL MERISTEM PROTEIN |
3swm_A | 6e-50 | 13 | 141 | 17 | 145 | NAC domain-containing protein 19 |
3swm_B | 6e-50 | 13 | 141 | 17 | 145 | NAC domain-containing protein 19 |
3swm_C | 6e-50 | 13 | 141 | 17 | 145 | NAC domain-containing protein 19 |
3swm_D | 6e-50 | 13 | 141 | 17 | 145 | NAC domain-containing protein 19 |
3swp_A | 6e-50 | 13 | 141 | 17 | 145 | NAC domain-containing protein 19 |
3swp_B | 6e-50 | 13 | 141 | 17 | 145 | NAC domain-containing protein 19 |
3swp_C | 6e-50 | 13 | 141 | 17 | 145 | NAC domain-containing protein 19 |
3swp_D | 6e-50 | 13 | 141 | 17 | 145 | NAC domain-containing protein 19 |
4dul_A | 7e-50 | 13 | 141 | 14 | 142 | NAC domain-containing protein 19 |
4dul_B | 7e-50 | 13 | 141 | 14 | 142 | NAC domain-containing protein 19 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Binds to the promoter regions of genes involved in chlorophyll catabolic processes, such as NYC1, SGR1, SGR2 and PAO. {ECO:0000269|PubMed:27021284}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | PGSC0003DMP400055799 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Repressed by the microRNA miR164. {ECO:0000269|PubMed:15294871, ECO:0000269|PubMed:17098808}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | HG975518 | 1e-151 | HG975518.1 Solanum lycopersicum chromosome ch06, complete genome. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_006354772.1 | 1e-113 | PREDICTED: NAC domain-containing protein 100-like | ||||
Swissprot | Q9FLJ2 | 3e-95 | NC100_ARATH; NAC domain-containing protein 100 | ||||
TrEMBL | M1D6G0 | 1e-157 | M1D6G0_SOLTU; Uncharacterized protein | ||||
STRING | PGSC0003DMT400083083 | 1e-112 | (Solanum tuberosum) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G61430.1 | 1e-97 | NAC domain containing protein 100 |
Link Out ? help Back to Top | |
---|---|
Phytozome | PGSC0003DMP400055799 |
Publications ? help Back to Top | |||
---|---|---|---|
|