PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | PGSC0003DMP400055718 | ||||||||
Common Name | LOC102605185 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
|
||||||||
Family | SBP | ||||||||
Protein Properties | Length: 166aa MW: 18812.9 Da PI: 10.4436 | ||||||||
Description | SBP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SBP | 134.9 | 2.5e-42 | 59 | 134 | 2 | 77 |
-SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS SBP 2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 Cq+e+C++dls+ak+yh+rhkvCe h+ka+vv+v+gl+qrfCqqCsrfhel+efDe+krsCrrrLa+hnerrrk++ PGSC0003DMP400055718 59 CQAEKCNVDLSDAKQYHKRHKVCEYHAKAQVVVVAGLRQRFCQQCSRFHELTEFDESKRSCRRRLAGHNERRRKST 134 **************************************************************************87 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:4.10.1100.10 | 3.8E-33 | 53 | 120 | IPR004333 | Transcription factor, SBP-box |
PROSITE profile | PS51141 | 32.206 | 56 | 133 | IPR004333 | Transcription factor, SBP-box |
SuperFamily | SSF103612 | 7.85E-39 | 58 | 136 | IPR004333 | Transcription factor, SBP-box |
Pfam | PF03110 | 2.9E-32 | 59 | 132 | IPR004333 | Transcription factor, SBP-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0010321 | Biological Process | regulation of vegetative phase change | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 166 aa Download sequence Send to blast |
METANNNQLK SMEKNDDFLV ISTSENAKKK IITTNNNNNK KLSSSSNSSS SSSSLIRSCQ 60 AEKCNVDLSD AKQYHKRHKV CEYHAKAQVV VVAGLRQRFC QQCSRFHELT EFDESKRSCR 120 RRLAGHNERR RKSTSSSSSS SSTDQSHRIH ISIQENSTHK NIHLR* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1ul4_A | 1e-38 | 49 | 132 | 1 | 84 | squamosa promoter binding protein-like 4 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcriptional factor. Binds to the promoter of the SQUAMOSA gene. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00634 | PBM | Transfer from PK22320.1 | Download |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | PGSC0003DMP400055718 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | HG975519 | 2e-98 | HG975519.1 Solanum lycopersicum chromosome ch07, complete genome. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_006367482.1 | 1e-115 | PREDICTED: squamosa promoter-binding protein 1-like | ||||
Swissprot | Q38741 | 1e-42 | SBP1_ANTMA; Squamosa promoter-binding protein 1 | ||||
TrEMBL | M1D693 | 1e-113 | M1D693_SOLTU; Uncharacterized protein | ||||
STRING | PGSC0003DMT400082789 | 1e-114 | (Solanum tuberosum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA749 | 24 | 105 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G15270.1 | 6e-40 | squamosa promoter binding protein-like 5 |
Link Out ? help Back to Top | |
---|---|
Phytozome | PGSC0003DMP400055718 |
Entrez Gene | 102605185 |
Publications ? help Back to Top | |||
---|---|---|---|
|