PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | PGSC0003DMP400051813 | ||||||||
Common Name | LOC102590664 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 196aa MW: 22592.9 Da PI: 4.3467 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 121 | 1.1e-37 | 8 | 126 | 1 | 128 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkd 89 lppGfrF Ptdeelvv++L++k++ +++ +vi+++++y ++PwdL+ k+ e ++wyf+s+r + +r+t++gyWk+ g d PGSC0003DMP400051813 8 LPPGFRFYPTDEELVVHFLQRKAALLPCHP-DVIPDLNLYPYDPWDLDGKAMVEGNKWYFYSRRTQ--------SRITENGYWKSLGVD 87 79*************************999.99**************977777899******9854........799************ PP NAM 90 kevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128 ++++s+++++vg+kk +fy g+ p+g+kt+Wvm+e++l PGSC0003DMP400051813 88 EPIFSTDNNNVGMKKYYAFYLGELPEGVKTNWVMQEFSL 126 *************************************97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF101941 | 8.11E-48 | 6 | 159 | IPR003441 | NAC domain |
PROSITE profile | PS51005 | 45.361 | 8 | 160 | IPR003441 | NAC domain |
Pfam | PF02365 | 6.3E-22 | 9 | 126 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0010089 | Biological Process | xylem development | ||||
GO:0043067 | Biological Process | regulation of programmed cell death | ||||
GO:0048367 | Biological Process | shoot system development | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 196 aa Download sequence Send to blast |
MGDSNVNLPP GFRFYPTDEE LVVHFLQRKA ALLPCHPDVI PDLNLYPYDP WDLDGKAMVE 60 GNKWYFYSRR TQSRITENGY WKSLGVDEPI FSTDNNNVGM KKYYAFYLGE LPEGVKTNWV 120 MQEFSLNSDS SSGNSRSSSR RRTRSKIDYS GWVICRVYER NYDNNDDDDD NGPELSCLDE 180 VFLSLDDLDE ISLPH* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1ut4_A | 5e-40 | 4 | 161 | 13 | 166 | NO APICAL MERISTEM PROTEIN |
1ut4_B | 5e-40 | 4 | 161 | 13 | 166 | NO APICAL MERISTEM PROTEIN |
1ut7_A | 5e-40 | 4 | 161 | 13 | 166 | NO APICAL MERISTEM PROTEIN |
1ut7_B | 5e-40 | 4 | 161 | 13 | 166 | NO APICAL MERISTEM PROTEIN |
3swm_A | 5e-40 | 4 | 161 | 16 | 169 | NAC domain-containing protein 19 |
3swm_B | 5e-40 | 4 | 161 | 16 | 169 | NAC domain-containing protein 19 |
3swm_C | 5e-40 | 4 | 161 | 16 | 169 | NAC domain-containing protein 19 |
3swm_D | 5e-40 | 4 | 161 | 16 | 169 | NAC domain-containing protein 19 |
3swp_A | 5e-40 | 4 | 161 | 16 | 169 | NAC domain-containing protein 19 |
3swp_B | 5e-40 | 4 | 161 | 16 | 169 | NAC domain-containing protein 19 |
3swp_C | 5e-40 | 4 | 161 | 16 | 169 | NAC domain-containing protein 19 |
3swp_D | 5e-40 | 4 | 161 | 16 | 169 | NAC domain-containing protein 19 |
4dul_A | 5e-40 | 4 | 161 | 13 | 166 | NAC domain-containing protein 19 |
4dul_B | 5e-40 | 4 | 161 | 13 | 166 | NAC domain-containing protein 19 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor that influences tracheary elements and xylem development by negatively regulating secondary cell wall fiber synthesis and programmed cell death. {ECO:0000269|PubMed:18069942, ECO:0000269|PubMed:20458494}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | PGSC0003DMP400051813 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | HG975440 | 1e-121 | HG975440.1 Solanum pennellii chromosome ch01, complete genome. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_015166144.1 | 1e-143 | PREDICTED: NAC transcription factor 25 | ||||
Swissprot | Q8GWK6 | 1e-81 | NC104_ARATH; NAC domain-containing protein 104 | ||||
TrEMBL | M1CWU9 | 1e-142 | M1CWU9_SOLTU; Uncharacterized protein | ||||
STRING | PGSC0003DMT400076481 | 1e-142 | (Solanum tuberosum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA3766 | 24 | 47 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G64530.1 | 4e-77 | xylem NAC domain 1 |
Link Out ? help Back to Top | |
---|---|
Phytozome | PGSC0003DMP400051813 |
Entrez Gene | 102590664 |
Publications ? help Back to Top | |||
---|---|---|---|
|