PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | PGSC0003DMP400039562 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
|
||||||||
Family | VOZ | ||||||||
Protein Properties | Length: 159aa MW: 17137.3 Da PI: 4.8358 | ||||||||
Description | VOZ family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | VOZ | 155.2 | 3.9e-48 | 53 | 148 | 1 | 93 |
VOZ 1 pppsaflgpkcalwdctrpaqgsewl...qdycssfhatlalneglpgttpvlrpkgidlkdgllfaalsakvqgkevgipecegaata 86 pppsaflgpkcalwdc+rpa gs+w+ qdycs +ha+la neg pg pv+rp gi+lkd+llf+alsak++gk+vg+pecegaata PGSC0003DMP400039562 53 PPPSAFLGPKCALWDCPRPAMGSDWCqksQDYCSDYHASLAPNEGYPGRPPVVRPMGIGLKDNLLFQALSAKAHGKDVGVPECEGAATA 141 89***********************944459********************************************************** PP VOZ 87 kspwnaa 93 kspwna+ PGSC0003DMP400039562 142 KSPWNAP 148 ******8 PP |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 159 aa Download sequence Send to blast |
MVNNTGVNNL GIATQLDYHS FDLHHEYDQQ YLPGFDALNL CLEDAMPPIH ISPPPSAFLG 60 PKCALWDCPR PAMGSDWCQK SQDYCSDYHA SLAPNEGYPG RPPVVRPMGI GLKDNLLFQA 120 LSAKAHGKDV GVPECEGAAT AKSPWNAPGE SSGAYLYF* |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcriptional activator acting positively in the phytochrome B signaling pathway. Functions redundantly with VOZ2 to promote flowering downstream of phytochrome B (phyB). Down-regulates 'FLOWERING LOCUS C' (FLC) and up-regulates 'FLOWERING LOCUS T' (FT). Binds to the 38-bp cis-acting region of the AVP1 gene. Interacts with phyB in the cytoplasm and is translocated to the nucleus at signal transmission, where it is subjected to degradation in a phytochrome-dependent manner. {ECO:0000269|PubMed:15295067, ECO:0000269|PubMed:22904146}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | PGSC0003DMP400039562 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By far-red light. {ECO:0000269|PubMed:22904146}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | HG975522 | 0.0 | HG975522.1 Solanum lycopersicum chromosome ch10, complete genome. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_006361045.1 | 1e-107 | PREDICTED: transcription factor VOZ1 | ||||
Refseq | XP_006361046.1 | 1e-107 | PREDICTED: transcription factor VOZ1 | ||||
Refseq | XP_006361047.1 | 1e-107 | PREDICTED: transcription factor VOZ1 | ||||
Swissprot | Q9SGQ0 | 1e-49 | VOZ1_ARATH; Transcription factor VOZ1 | ||||
TrEMBL | M1C375 | 1e-114 | M1C375_SOLTU; Uncharacterized protein | ||||
STRING | PGSC0003DMT400058735 | 1e-106 | (Solanum tuberosum) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G28520.2 | 4e-52 | vascular plant one zinc finger protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | PGSC0003DMP400039562 |
Publications ? help Back to Top | |||
---|---|---|---|
|