PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | PGSC0003DMP400033616 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
|
||||||||
Family | HSF | ||||||||
Protein Properties | Length: 107aa MW: 12032.5 Da PI: 6.5044 | ||||||||
Description | HSF family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | HSF_DNA-bind | 78.7 | 9.2e-25 | 39 | 99 | 2 | 62 |
HHHHHHHHHCTGGGTTTSEESSSSSEEEES-HHHHHHHTHHHHSTT--HHHHHHHHHHTTE CS HSF_DNA-bind 2 FlkklyeiledeelkeliswsengnsfvvldeeefakkvLpkyFkhsnfaSFvRQLnmYgF 62 Fl+k+ye+++d+++++++sw++ g+sfvv+d++ f++++Lp++Fkh+nf+SFvRQ n+Y + PGSC0003DMP400033616 39 FLTKTYEMVDDSTIDHVVSWNRGGQSFVVWDPHAFSTTLLPRFFKHNNFSSFVRQQNTYYW 99 9**********************************************************87 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.10.10 | 6.9E-27 | 33 | 100 | IPR011991 | Winged helix-turn-helix DNA-binding domain |
SuperFamily | SSF46785 | 4.9E-23 | 35 | 100 | IPR011991 | Winged helix-turn-helix DNA-binding domain |
SMART | SM00415 | 3.2E-21 | 35 | 106 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
Pfam | PF00447 | 1.3E-20 | 39 | 99 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
PRINTS | PR00056 | 4.8E-14 | 39 | 62 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
PRINTS | PR00056 | 4.8E-14 | 77 | 89 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
PRINTS | PR00056 | 4.8E-14 | 90 | 102 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 107 aa Download sequence Send to blast |
MNQLYSVKEE FPGSSSGGKP PPPTPQPMEG LHDIGPPPFL TKTYEMVDDS TIDHVVSWNR 60 GGQSFVVWDP HAFSTTLLPR FFKHNNFSSF VRQQNTYYWT ICGLPN* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5d8k_B | 2e-15 | 37 | 97 | 3 | 63 | Heat shock factor protein 2 |
5d8l_B | 2e-15 | 37 | 97 | 3 | 63 | Heat shock factor protein 2 |
5d8l_D | 2e-15 | 37 | 97 | 3 | 63 | Heat shock factor protein 2 |
5d8l_F | 2e-15 | 37 | 97 | 3 | 63 | Heat shock factor protein 2 |
5d8l_H | 2e-15 | 37 | 97 | 3 | 63 | Heat shock factor protein 2 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcriptional activator that specifically binds DNA sequence 5'-AGAAnnTTCT-3' known as heat shock promoter elements (HSE). |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | PGSC0003DMP400033616 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | HG975521 | 6e-88 | HG975521.1 Solanum lycopersicum chromosome ch09, complete genome. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_015165187.1 | 5e-66 | PREDICTED: heat stress transcription factor A-7a-like | ||||
Swissprot | Q9M1V5 | 9e-37 | HFA7B_ARATH; Heat stress transcription factor A-7b | ||||
TrEMBL | M1BPC5 | 2e-73 | M1BPC5_SOLTU; Uncharacterized protein | ||||
STRING | PGSC0003DMT400049803 | 3e-74 | (Solanum tuberosum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA572 | 24 | 113 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G51910.1 | 4e-37 | heat shock transcription factor A7A |
Link Out ? help Back to Top | |
---|---|
Phytozome | PGSC0003DMP400033616 |
Publications ? help Back to Top | |||
---|---|---|---|
|