PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Home  TFext  BLAST  Prediction  Download  Help  About  Links  PlantRegMap
(e.g., LFY)
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PGSC0003DMP400033615
Organism
Solanum tuberosum
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family HSF
Protein Properties Length: 75aa    MW: 8545.57 Da    PI: 6.5055
Description HSF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PGSC0003DMP400033615genomePGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HSF_DNA-bind78.41.2e-241270260
                          HHHHHHHHHCTGGGTTTSEESSSSSEEEES-HHHHHHHTHHHHSTT--HHHHHHHHHHT CS
          HSF_DNA-bind  2 FlkklyeiledeelkeliswsengnsfvvldeeefakkvLpkyFkhsnfaSFvRQLnmY 60
                          Fl+k+ye+++d+++++++sw++ g+sfvv+d++ f++++Lp++Fkh+nf+SFvRQ n+Y
  PGSC0003DMP400033615 12 FLTKTYEMVDDSTIDHVVSWNRGGQSFVVWDPHAFSTTLLPRFFKHNNFSSFVRQQNTY 70
                          9*********************************************************9 PP
Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.108.9E-27670IPR011991Winged helix-turn-helix DNA-binding domain
SMARTSM004152.6E-17874IPR000232Heat shock factor (HSF)-type, DNA-binding
SuperFamilySSF467858.84E-23870IPR011991Winged helix-turn-helix DNA-binding domain
PfamPF004471.2E-201270IPR000232Heat shock factor (HSF)-type, DNA-binding
PRINTSPR000566.6E-141235IPR000232Heat shock factor (HSF)-type, DNA-binding
PRINTSPR000566.6E-145062IPR000232Heat shock factor (HSF)-type, DNA-binding
PRINTSPR000566.6E-146374IPR000232Heat shock factor (HSF)-type, DNA-binding
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 75 aa     Download sequence    Send to blast
MEGLHDIGPP PFLTKTYEMV DDSTIDHVVS WNRGGQSFVV WDPHAFSTTL LPRFFKHNNF  60
SSFVRQQNTY VSIT*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5d8k_B7e-161070363Heat shock factor protein 2
5d8l_B7e-161070363Heat shock factor protein 2
5d8l_D7e-161070363Heat shock factor protein 2
5d8l_F7e-161070363Heat shock factor protein 2
5d8l_H7e-161070363Heat shock factor protein 2
5hdk_A7e-161070868Heat shock factor protein 2
5hdk_B7e-161070868Heat shock factor protein 2
5hdk_C7e-161070868Heat shock factor protein 2
5hdk_D7e-161070868Heat shock factor protein 2
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator that specifically binds DNA sequence 5'-AGAAnnTTCT-3' known as heat shock promoter elements (HSE).
Cis-element ? help Back to Top
SourceLink
PlantRegMapPGSC0003DMP400033615
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754484e-79HG975448.1 Solanum pennellii chromosome ch09, complete genome.
GenBankHG9755214e-79HG975521.1 Solanum lycopersicum chromosome ch09, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009785112.13e-45PREDICTED: heat stress transcription factor A-7a isoform X1
RefseqXP_015165187.15e-46PREDICTED: heat stress transcription factor A-7a-like
RefseqXP_016472860.13e-45PREDICTED: heat stress transcription factor A-7a-like isoform X1
SwissprotQ9SV123e-36HFA7A_ARATH; Heat stress transcription factor A-7a
TrEMBLM1BPC43e-48M1BPC4_SOLTU; Uncharacterized protein
STRINGXP_009785112.11e-44(Nicotiana sylvestris)
STRINGPGSC0003DMT4000498035e-46(Solanum tuberosum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G51910.11e-38heat shock transcription factor A7A
Publications ? help Back to Top
  1. Xu X, et al.
    Genome sequence and analysis of the tuber crop potato.
    Nature, 2011. 475(7355): p. 189-95
    [PMID:21743474]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  3. Guan Q,Yue X,Zeng H,Zhu J
    The protein phosphatase RCF2 and its interacting partner NAC019 are critical for heat stress-responsive gene regulation and thermotolerance in Arabidopsis.
    Plant Cell, 2014. 26(1): p. 438-53
    [PMID:24415771]
  4. Nie S,Yue H,Xing D
    A Potential Role for Mitochondrial Produced Reactive Oxygen Species in Salicylic Acid-Mediated Plant Acquired Thermotolerance.
    Plant Physiol., 2016.
    [PMID:26099269]