PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | PGSC0003DMP400015242 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 168aa MW: 19754.8 Da PI: 10.2553 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 148.6 | 3.1e-46 | 9 | 135 | 3 | 128 |
NAM 3 pGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdke 91 pGfrFhPt+eel+++yLk+ ++++k++ ++i ++iy ++Pw+Lp +++ +e+ewyfF++ ++k+ + r+nr+t+sg+Wkatg+d++ PGSC0003DMP400015242 9 PGFRFHPTEEELINFYLKRIINDDKIDS-NTIGFLNIYLYDPWELPGMARIGEREWYFFVPINRKHGPKGRPNRTTRSGFWKATGSDRQ 96 9**************************9.88***************8888999************************************ PP NAM 92 vlsk..kgelvglkktLvfykgrapkgektdWvmheyrl 128 + s+ ++++glkktLvfy grapkg++tdWvm+eyrl PGSC0003DMP400015242 97 IRSSlePKKAIGLKKTLVFYGGRAPKGTRTDWVMNEYRL 135 **99888889***************************98 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51005 | 48.044 | 7 | 159 | IPR003441 | NAC domain |
SuperFamily | SSF101941 | 1.57E-50 | 8 | 141 | IPR003441 | NAC domain |
Pfam | PF02365 | 9.4E-26 | 9 | 135 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 168 aa Download sequence Send to blast |
MSLTELELPG FRFHPTEEEL INFYLKRIIN DDKIDSNTIG FLNIYLYDPW ELPGMARIGE 60 REWYFFVPIN RKHGPKGRPN RTTRSGFWKA TGSDRQIRSS LEPKKAIGLK KTLVFYGGRA 120 PKGTRTDWVM NEYRLPHGHK VLQFIMQTHN AKLYRYFVSS CIYLFIF* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
3ulx_A | 3e-40 | 4 | 135 | 11 | 140 | Stress-induced transcription factor NAC1 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription activator that binds sequence-specific DNA motifs. Involved in stress response. Plays a positive role in drought and salt stress tolerance through the modulation of abscisic acid-mediated signaling. {ECO:0000269|PubMed:26834774}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | PGSC0003DMP400015242 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Induced by drought stress, salt stress and abscisic acid (ABA). {ECO:0000269|PubMed:26834774}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | HG975441 | 1e-126 | HG975441.1 Solanum pennellii chromosome ch02, complete genome. | |||
GenBank | HG975514 | 1e-126 | HG975514.1 Solanum lycopersicum chromosome ch02, complete genome. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_015160762.1 | 1e-103 | PREDICTED: NAC transcription factor 25-like isoform X1 | ||||
Swissprot | Q10S65 | 2e-68 | NAC22_ORYSJ; NAC domain-containing protein 22 | ||||
TrEMBL | M1AGL5 | 1e-121 | M1AGL5_SOLTU; Uncharacterized protein | ||||
STRING | PGSC0003DMT400022365 | 1e-101 | (Solanum tuberosum) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G17040.1 | 3e-67 | NAC domain containing protein 36 |
Link Out ? help Back to Top | |
---|---|
Phytozome | PGSC0003DMP400015242 |
Publications ? help Back to Top | |||
---|---|---|---|
|