PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | PGSC0003DMP400015241 | ||||||||
Common Name | LOC102591339 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 246aa MW: 28243.1 Da PI: 6.89 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 147 | 9.5e-46 | 9 | 135 | 3 | 128 |
NAM 3 pGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdke 91 pGfrFhPt+eel+++yLk+ ++++k++ ++i ++iy ++Pw+Lp +++ +e+ewyfF++ ++k+ + r+nr+t+sg+Wkatg+d++ PGSC0003DMP400015241 9 PGFRFHPTEEELINFYLKRIINDDKIDS-NTIGFLNIYLYDPWELPGMARIGEREWYFFVPINRKHGPKGRPNRTTRSGFWKATGSDRQ 96 9**************************9.88***************8888999************************************ PP NAM 92 vlsk..kgelvglkktLvfykgrapkgektdWvmheyrl 128 + s+ ++++glkktLvfy grapkg++tdWvm+eyrl PGSC0003DMP400015241 97 IRSSlePKKAIGLKKTLVFYGGRAPKGTRTDWVMNEYRL 135 **99888889***************************98 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51005 | 52.131 | 7 | 152 | IPR003441 | NAC domain |
SuperFamily | SSF101941 | 2.88E-53 | 8 | 152 | IPR003441 | NAC domain |
Pfam | PF02365 | 3.0E-25 | 9 | 135 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 246 aa Download sequence Send to blast |
MSLTELELPG FRFHPTEEEL INFYLKRIIN DDKIDSNTIG FLNIYLYDPW ELPGMARIGE 60 REWYFFVPIN RKHGPKGRPN RTTRSGFWKA TGSDRQIRSS LEPKKAIGLK KTLVFYGGRA 120 PKGTRTDWVM NEYRLPHGHK DHDIVLCKVY RKATSFKVLE ERAMIEEDAA KPYLASAAPH 180 DESQDMLVSL ESSSKNDMYF KSCEEENHEL LGSNAFVEPP KFSIDSLSSP LWSTGQDLWT 240 LFSLS* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1ut4_A | 6e-43 | 3 | 155 | 12 | 168 | NO APICAL MERISTEM PROTEIN |
1ut4_B | 6e-43 | 3 | 155 | 12 | 168 | NO APICAL MERISTEM PROTEIN |
1ut7_A | 6e-43 | 3 | 155 | 12 | 168 | NO APICAL MERISTEM PROTEIN |
1ut7_B | 6e-43 | 3 | 155 | 12 | 168 | NO APICAL MERISTEM PROTEIN |
3swm_A | 6e-43 | 3 | 155 | 15 | 171 | NAC domain-containing protein 19 |
3swm_B | 6e-43 | 3 | 155 | 15 | 171 | NAC domain-containing protein 19 |
3swm_C | 6e-43 | 3 | 155 | 15 | 171 | NAC domain-containing protein 19 |
3swm_D | 6e-43 | 3 | 155 | 15 | 171 | NAC domain-containing protein 19 |
3swp_A | 6e-43 | 3 | 155 | 15 | 171 | NAC domain-containing protein 19 |
3swp_B | 6e-43 | 3 | 155 | 15 | 171 | NAC domain-containing protein 19 |
3swp_C | 6e-43 | 3 | 155 | 15 | 171 | NAC domain-containing protein 19 |
3swp_D | 6e-43 | 3 | 155 | 15 | 171 | NAC domain-containing protein 19 |
4dul_A | 6e-43 | 3 | 155 | 12 | 168 | NAC domain-containing protein 19 |
4dul_B | 6e-43 | 3 | 155 | 12 | 168 | NAC domain-containing protein 19 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription activator that binds sequence-specific DNA motifs. Involved in stress response. Plays a positive role in drought and salt stress tolerance through the modulation of abscisic acid-mediated signaling. {ECO:0000269|PubMed:26834774}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | PGSC0003DMP400015241 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Induced by drought stress, salt stress and abscisic acid (ABA). {ECO:0000269|PubMed:26834774}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | HG975441 | 1e-125 | HG975441.1 Solanum pennellii chromosome ch02, complete genome. | |||
GenBank | HG975514 | 1e-125 | HG975514.1 Solanum lycopersicum chromosome ch02, complete genome. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_006367161.1 | 0.0 | PREDICTED: NAC transcription factor 25-like isoform X2 | ||||
Swissprot | Q10S65 | 8e-80 | NAC22_ORYSJ; NAC domain-containing protein 22 | ||||
TrEMBL | M1AGL4 | 0.0 | M1AGL4_SOLTU; Uncharacterized protein | ||||
STRING | PGSC0003DMT400022365 | 0.0 | (Solanum tuberosum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA3531 | 22 | 48 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G17040.1 | 3e-79 | NAC domain containing protein 36 |
Link Out ? help Back to Top | |
---|---|
Phytozome | PGSC0003DMP400015241 |
Entrez Gene | 102591339 |
Publications ? help Back to Top | |||
---|---|---|---|
|