PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | PGSC0003DMP400014627 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 241aa MW: 27490.2 Da PI: 8.3615 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 46.7 | 7.2e-15 | 7 | 54 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+W++eEd++l ++ ++G +Wk ++ g+ Rt+k+c++rw +yl PGSC0003DMP400014627 7 KGAWSPEEDQKLRGYIMKYGIWNWKQMPKFAGLSRTGKSCRLRWMNYL 54 79******************99************************97 PP | |||||||
2 | Myb_DNA-binding | 40.7 | 5.4e-13 | 60 | 104 | 1 | 47 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 rg++T eE e+ ++ ++lG+ W++Ia++++ gRt++++k++++ + PGSC0003DMP400014627 60 RGPFTMEEVEIVIKTYQELGNS-WSAIAAKLP-GRTDNEVKNFFHAH 104 89******************99.*********.**********9866 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 21.17 | 2 | 58 | IPR017930 | Myb domain |
SMART | SM00717 | 1.1E-11 | 6 | 56 | IPR001005 | SANT/Myb domain |
SuperFamily | SSF46689 | 8.8E-29 | 6 | 101 | IPR009057 | Homeodomain-like |
Pfam | PF00249 | 3.2E-13 | 7 | 54 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 8.1E-22 | 8 | 61 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 1.15E-9 | 9 | 54 | No hit | No description |
PROSITE profile | PS51294 | 15.755 | 59 | 109 | IPR017930 | Myb domain |
SMART | SM00717 | 5.7E-11 | 59 | 107 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 2.3E-11 | 60 | 104 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 1.77E-7 | 62 | 105 | No hit | No description |
Gene3D | G3DSA:1.10.10.60 | 1.1E-22 | 62 | 109 | IPR009057 | Homeodomain-like |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 241 aa Download sequence Send to blast |
MEEIIKKGAW SPEEDQKLRG YIMKYGIWNW KQMPKFAGLS RTGKSCRLRW MNYLRPDVRR 60 GPFTMEEVEI VIKTYQELGN SWSAIAAKLP GRTDNEVKNF FHAHLKKHLG LKNHDALLKT 120 RKSRKQTKED EKKNSTRGRL VLETSNNSSS LTTGVCSPCS SIITCEENQM MDPFVNFSQT 180 FEDCYNNVTS LVVDQQVSDM ENTCTNIGVA QPYSIPHGSA VNSFDQFDMN SFWIDVLGNI 240 * |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1h8a_C | 7e-23 | 5 | 107 | 25 | 126 | MYB TRANSFORMING PROTEIN |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor involved in cold-regulation of CBF genes and in the development of freezing tolerance. May be part of a complex network of transcription factors controlling the expression of CBF genes and other genes in response to cold stress. Binds to the MYB recognition sequences in the promoters of CBF1, CBF2 and CBF3 genes (PubMed:17015446). Involved in drought and salt tolerance. May enhance expression levels of genes involved in abscisic acid (ABA) biosynthesis and signaling, as well as those encoding stress-protective proteins (PubMed:19161942). {ECO:0000269|PubMed:17015446, ECO:0000269|PubMed:19161942}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | PGSC0003DMP400014627 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Induced by abscisic acid (ABA) and drought stress (PubMed:19161942). Induced by salt stress (PubMed:19161942). {ECO:0000269|PubMed:19161942}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | HG975442 | 0.0 | HG975442.1 Solanum pennellii chromosome ch03, complete genome. | |||
GenBank | HG975515 | 0.0 | HG975515.1 Solanum lycopersicum chromosome ch03, complete genome. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_006358196.1 | 0.0 | PREDICTED: myb-related protein 308-like | ||||
Swissprot | Q9LTC4 | 5e-47 | MYB15_ARATH; Transcription factor MYB15 | ||||
TrEMBL | M1AF71 | 0.0 | M1AF71_SOLTU; Uncharacterized protein | ||||
STRING | PGSC0003DMT400021498 | 0.0 | (Solanum tuberosum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA12 | 24 | 2154 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G23250.1 | 5e-47 | myb domain protein 15 |
Link Out ? help Back to Top | |
---|---|
Phytozome | PGSC0003DMP400014627 |