PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | PGSC0003DMP400009906 | ||||||||
Common Name | LOC102604472 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 298aa MW: 32639.4 Da PI: 7.1263 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 23.3 | 1.5e-07 | 10 | 58 | 3 | 48 |
SS-HHHHHHHHHHHHHTTTT....-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 3 rWTteEdellvdavkqlGgg....tWktIartmgkgRtlkqcksrwqkyl 48 W+ eE++ + +a++++ + +W+ a++++ ++t ++k+++q +l PGSC0003DMP400009906 10 VWSREEEKAFENAIALHWVEdseqQWEQFASMVP-TKTIDELKEHYQLLL 58 6*****************99**************.************875 PP | |||||||
2 | Myb_DNA-binding | 38.9 | 1.9e-12 | 135 | 179 | 3 | 47 |
SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 +WT+eE+ l++ + ++G+g+W++I+r + Rt+ q+ s+ qky PGSC0003DMP400009906 135 PWTEEEHRLFLLGLDKFGKGDWRSISRNFVISRTPTQVASHAQKY 179 7*****************************99************9 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51293 | 6.581 | 6 | 62 | IPR017884 | SANT domain |
SMART | SM00717 | 9.6E-4 | 7 | 60 | IPR001005 | SANT/Myb domain |
SuperFamily | SSF46689 | 1.29E-7 | 11 | 64 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 2.60E-6 | 11 | 58 | No hit | No description |
PROSITE profile | PS51294 | 16.873 | 128 | 184 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 7.18E-17 | 130 | 185 | IPR009057 | Homeodomain-like |
TIGRFAMs | TIGR01557 | 4.1E-17 | 132 | 182 | IPR006447 | Myb domain, plants |
SMART | SM00717 | 2.3E-10 | 132 | 182 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 6.3E-11 | 133 | 178 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 9.83E-10 | 135 | 180 | No hit | No description |
Pfam | PF00249 | 7.3E-11 | 135 | 179 | IPR001005 | SANT/Myb domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0009651 | Biological Process | response to salt stress | ||||
GO:0009733 | Biological Process | response to auxin | ||||
GO:0009739 | Biological Process | response to gibberellin | ||||
GO:0009751 | Biological Process | response to salicylic acid | ||||
GO:0009753 | Biological Process | response to jasmonic acid | ||||
GO:0046686 | Biological Process | response to cadmium ion | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 298 aa Download sequence Send to blast |
MSPSDSSSVV WSREEEKAFE NAIALHWVED SEQQWEQFAS MVPTKTIDEL KEHYQLLLED 60 VAAIEAGQVP IPNYKGEEAS SSSTKEVNLG YPGSVDGRRS NCGYSNGFSG TTHDPIGHGG 120 KGNSRSEQER RKGIPWTEEE HRLFLLGLDK FGKGDWRSIS RNFVISRTPT QVASHAQKYF 180 IRLNSMNRDR RRSSIHDITS INNGGDVSTH QAPITGQQVN PNPSNPAALG PSVKHRTQPN 240 MHSMGMYGAP MGHPVAAPPS HLASAVGTPV MLPHGHHPPY VLPLAYPIPP PPPPMHQ* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
2cjj_A | 1e-12 | 1 | 75 | 1 | 74 | RADIALIS |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription activator that binds to 5'-TATCCA-3' elements in gene promoters. Derepresses strongly the sugar-repressed transcription of promoters containing SRS or 5'-TATCCA-3' elements. Functions with GAMYB to integrate diverse nutrient starvation and gibberellin (GA) signaling pathways during germination of grains. Sugar, nitrogen and phosphate starvation signals converge and interconnect with GA to promote the co-nuclear import of MYBS1 and GAMYB, resulting in the expression of a large set of GA-inducible hydrolases, transporters, and regulators that are essential for mobilization of nutrient reserves in the endosperm to support seedling growth (PubMed:22773748). {ECO:0000269|PubMed:12172034, ECO:0000269|PubMed:22773748}. | |||||
UniProt | Transcription activator that binds to 5'-TATCCA-3' elements in gene promoters. Derepress strongly the sugar-repressed transcription of promoters containing SRS or 5'-TATCCA-3' elements. {ECO:0000250|UniProtKB:Q8LH59}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00191 | DAP | Transfer from AT1G49010 | Download |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | PGSC0003DMP400009906 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Repressed by sucrose and gibberellic acid (GA). {ECO:0000269|PubMed:12172034}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | HG975442 | 0.0 | HG975442.1 Solanum pennellii chromosome ch03, complete genome. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_006341637.1 | 0.0 | PREDICTED: transcription factor DIVARICATA | ||||
Swissprot | B8A9B2 | 3e-83 | MYBS1_ORYSI; Transcription factor MYBS1 | ||||
Swissprot | Q8LH59 | 3e-83 | MYBS1_ORYSJ; Transcription factor MYBS1 | ||||
TrEMBL | M1A421 | 0.0 | M1A421_SOLTU; Uncharacterized protein | ||||
STRING | PGSC0003DMT400014350 | 0.0 | (Solanum tuberosum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA5801 | 21 | 36 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G49010.1 | 1e-79 | MYB family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | PGSC0003DMP400009906 |
Entrez Gene | 102604472 |
Publications ? help Back to Top | |||
---|---|---|---|
|