PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | PGSC0003DMP400009699 | ||||||||
Common Name | LOC102598573 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 197aa MW: 22833.3 Da PI: 5.4858 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 116.3 | 3.1e-36 | 9 | 128 | 1 | 127 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkd 89 lppGf F P+deel+v++L++k++ +++ +vi+++++++++PwdL+ k+ ++ ++wyf+s+r + +++r+t++gyWk g d PGSC0003DMP400009699 9 LPPGFWFCPSDEELIVHFLHRKISLLPCHP-DVIPDLHLHHYDPWDLDGKAMTGGNKWYFYSRRTH------ETSRITNNGYWKPLGVD 90 79*************************999.99**************977778899******9977......578************** PP NAM 90 kevlskkgelvglkktLvfykgrapkgektdWvmheyr 127 +++ls+++++ g+kk +fy g+ p+g+kt+W+m+ey+ PGSC0003DMP400009699 91 ETILSTSNHNLGMKKYYTFYMGQPPQGHKTNWLMQEYS 128 *************************************7 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF101941 | 1.31E-45 | 7 | 161 | IPR003441 | NAC domain |
PROSITE profile | PS51005 | 42.318 | 9 | 162 | IPR003441 | NAC domain |
Pfam | PF02365 | 9.7E-20 | 10 | 128 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 197 aa Download sequence Send to blast |
MGDNNNVKLP PGFWFCPSDE ELIVHFLHRK ISLLPCHPDV IPDLHLHHYD PWDLDGKAMT 60 GGNKWYFYSR RTHETSRITN NGYWKPLGVD ETILSTSNHN LGMKKYYTFY MGQPPQGHKT 120 NWLMQEYSHI SNSSPSPSSS RRRRSQSKTD YSKWVICRVY ESNCDSDEND DPELSCLDEV 180 FLSLDDLDDD EISLIN* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
3swm_A | 4e-36 | 5 | 168 | 16 | 174 | NAC domain-containing protein 19 |
3swm_B | 4e-36 | 5 | 168 | 16 | 174 | NAC domain-containing protein 19 |
3swm_C | 4e-36 | 5 | 168 | 16 | 174 | NAC domain-containing protein 19 |
3swm_D | 4e-36 | 5 | 168 | 16 | 174 | NAC domain-containing protein 19 |
3swp_A | 4e-36 | 5 | 168 | 16 | 174 | NAC domain-containing protein 19 |
3swp_B | 4e-36 | 5 | 168 | 16 | 174 | NAC domain-containing protein 19 |
3swp_C | 4e-36 | 5 | 168 | 16 | 174 | NAC domain-containing protein 19 |
3swp_D | 4e-36 | 5 | 168 | 16 | 174 | NAC domain-containing protein 19 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor that influences tracheary elements and xylem development by negatively regulating secondary cell wall fiber synthesis and programmed cell death. {ECO:0000269|PubMed:18069942, ECO:0000269|PubMed:20458494}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | PGSC0003DMP400009699 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | HG975449 | 1e-121 | HG975449.1 Solanum pennellii chromosome ch10, complete genome. | |||
GenBank | HG975522 | 1e-121 | HG975522.1 Solanum lycopersicum chromosome ch10, complete genome. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_006341845.1 | 1e-145 | PREDICTED: NAC transcription factor 25-like | ||||
Swissprot | Q8GWK6 | 4e-72 | NC104_ARATH; NAC domain-containing protein 104 | ||||
TrEMBL | M1A3N3 | 1e-144 | M1A3N3_SOLTU; Uncharacterized protein | ||||
STRING | PGSC0003DMT400014030 | 1e-145 | (Solanum tuberosum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA3766 | 24 | 47 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G64530.1 | 2e-64 | xylem NAC domain 1 |
Link Out ? help Back to Top | |
---|---|
Phytozome | PGSC0003DMP400009699 |
Entrez Gene | 102598573 |
Publications ? help Back to Top | |||
---|---|---|---|
|