PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | PGSC0003DMP400001113 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 271aa MW: 30476.5 Da PI: 5.9272 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 172.6 | 1.2e-53 | 27 | 155 | 1 | 128 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp..kkvkaeekewyfFskrdkkyatgkrknratksgyWkatg 87 lp+G+rF+Ptdeelv++yL+ k++g + ++ +vi+evdi+k+ePwdLp + v+++++ew+fF+++d+ky++g+r nrat++gyWkatg PGSC0003DMP400001113 27 LPVGYRFRPTDEELVNHYLRLKINGADSQV-SVIREVDICKLEPWDLPdlSVVESHDNEWFFFCPKDRKYQNGQRLNRATERGYWKATG 114 799************************999.99**************96448888999******************************* PP NAM 88 kdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128 kd+++++kkg+++g+kktLv+y grap+g++t+Wv+heyr+ PGSC0003DMP400001113 115 KDRNIVTKKGAKIGMKKTLVYYIGRAPEGKRTHWVIHEYRA 155 ***************************************96 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF101941 | 2.88E-59 | 22 | 178 | IPR003441 | NAC domain |
PROSITE profile | PS51005 | 55.462 | 27 | 178 | IPR003441 | NAC domain |
Pfam | PF02365 | 2.4E-27 | 28 | 154 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0002230 | Biological Process | positive regulation of defense response to virus by host | ||||
GO:0002237 | Biological Process | response to molecule of bacterial origin | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0016021 | Cellular Component | integral component of membrane | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0003713 | Molecular Function | transcription coactivator activity | ||||
GO:0044212 | Molecular Function | transcription regulatory region DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 271 aa Download sequence Send to blast |
MAVLPGENPI AVLPVDKQMG IPPLNTLPVG YRFRPTDEEL VNHYLRLKIN GADSQVSVIR 60 EVDICKLEPW DLPDLSVVES HDNEWFFFCP KDRKYQNGQR LNRATERGYW KATGKDRNIV 120 TKKGAKIGMK KTLVYYIGRA PEGKRTHWVI HEYRATEKSL DGSHPGQGAF VLCRLFRKND 180 LKQDEHVENS NLDAEQNASV DKSPAEDELS EAATPLMVIQ PLSDCDKSYA AKFSKGEMYG 240 KQIPIESHSN SCIADDTEDQ MLDITSIPVS * |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
3swm_A | 4e-47 | 26 | 183 | 19 | 173 | NAC domain-containing protein 19 |
3swm_B | 4e-47 | 26 | 183 | 19 | 173 | NAC domain-containing protein 19 |
3swm_C | 4e-47 | 26 | 183 | 19 | 173 | NAC domain-containing protein 19 |
3swm_D | 4e-47 | 26 | 183 | 19 | 173 | NAC domain-containing protein 19 |
3swp_A | 4e-47 | 26 | 183 | 19 | 173 | NAC domain-containing protein 19 |
3swp_B | 4e-47 | 26 | 183 | 19 | 173 | NAC domain-containing protein 19 |
3swp_C | 4e-47 | 26 | 183 | 19 | 173 | NAC domain-containing protein 19 |
3swp_D | 4e-47 | 26 | 183 | 19 | 173 | NAC domain-containing protein 19 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription activator essential for the anti-viral defense called virus basal resistance response pathway (PubMed:11041886, PubMed:15629774, PubMed:18785827, PubMed:24418554). Not involved in HRT-mediated hypersensitive response (HR) and resistance to TCV (PubMed:18785827). Binds DNA non specifically (PubMed:15629774). Activated by proteolytic cleavage through regulated intramembrane proteolysis (RIP) (By similarity). {ECO:0000250|UniProtKB:Q9SCK6, ECO:0000269|PubMed:11041886, ECO:0000269|PubMed:15629774, ECO:0000269|PubMed:18785827, ECO:0000269|PubMed:24418554}.; FUNCTION: (Microbial infection) Compromised function in defense response pathway when interacting with the invading viral capsid protein (CP) of turnip crinkle virus (TCV) due to abnormal subcellular localization. {ECO:0000269|PubMed:11041886, ECO:0000269|PubMed:15629774}. | |||||
UniProt | Transcriptional activator activated by proteolytic cleavage through regulated intramembrane proteolysis (RIP) (PubMed:18443413, PubMed:24329768). Calmodulin-regulated transcriptional repressor. Binds several synthetic promoters with randomly selected binding sites (PubMed:17947243). Functions synergistically with SNI1 as negative regulator of pathogen-induced PR1 expression and basal resistance to a virulent strain of P.syringae. Binds directly to the promoter of the PR1 gene (PubMed:22826500). Acts as positive regulator of innate immunity. Involved in the effector-triggered immunity (ETI) induction of immunity-related gene expression (PubMed:24329768). Mediates osmotic stress signaling in leaf senescence by up-regulating senescence-associated genes (PubMed:18443413). {ECO:0000269|PubMed:17947243, ECO:0000269|PubMed:18443413, ECO:0000269|PubMed:22826500, ECO:0000269|PubMed:24329768}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | PGSC0003DMP400001113 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Induced by bacterial pathogens type III effector proteins (TTEs). {ECO:0000269|PubMed:16553893}.; INDUCTION: (Microbial infection) Accumulates 2 days post infection with turnip crinkle virus (TCV) (PubMed:24418554). {ECO:0000269|PubMed:24418554}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | KF437522 | 0.0 | KF437522.1 Solanum tuberosum putative membrane bound NAC transcription factor 1 mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | NP_001274765.1 | 0.0 | uncharacterized LOC102593794 | ||||
Swissprot | F4JN35 | 3e-77 | NTL9_ARATH; Protein NTM1-like 9 | ||||
Swissprot | Q9LKG8 | 2e-77 | NAC91_ARATH; NAC domain-containing protein 91 | ||||
TrEMBL | M0ZIK6 | 0.0 | M0ZIK6_SOLTU; Uncharacterized protein | ||||
STRING | PGSC0003DMT400001498 | 0.0 | (Solanum tuberosum) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G24590.2 | 7e-80 | TCV-interacting protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | PGSC0003DMP400001113 |