PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | PGSC0003DMP400000548 | ||||||||
Common Name | LOC102595015 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
|
||||||||
Family | NF-YA | ||||||||
Protein Properties | Length: 154aa MW: 17062.2 Da PI: 10.9578 | ||||||||
Description | NF-YA family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | CBFB_NFYA | 104.7 | 8.4e-33 | 17 | 73 | 1 | 58 |
CBFB_NFYA 1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 d p+YVNaKQy++Il+RRq Rakle+++kl k+rkpylheSRh hA++R RgsgGrF PGSC0003DMP400000548 17 DGPIYVNAKQYHGILRRRQIRAKLEAQNKL-VKNRKPYLHESRHLHAVNRVRGSGGRF 73 57****************************.**************************9 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00521 | 1.1E-35 | 15 | 76 | IPR001289 | Nuclear transcription factor Y subunit A |
PROSITE profile | PS51152 | 35.798 | 16 | 76 | IPR001289 | Nuclear transcription factor Y subunit A |
Pfam | PF02045 | 3.4E-28 | 19 | 73 | IPR001289 | Nuclear transcription factor Y subunit A |
PRINTS | PR00616 | 5.0E-24 | 19 | 41 | IPR001289 | Nuclear transcription factor Y subunit A |
PROSITE pattern | PS00686 | 0 | 21 | 41 | IPR018362 | CCAAT-binding factor, conserved site |
PRINTS | PR00616 | 5.0E-24 | 50 | 73 | IPR001289 | Nuclear transcription factor Y subunit A |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0016602 | Cellular Component | CCAAT-binding factor complex | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 154 aa Download sequence Send to blast |
MGIAPARVPL PIDMAEDGPI YVNAKQYHGI LRRRQIRAKL EAQNKLVKNR KPYLHESRHL 60 HAVNRVRGSG GRFLSSKKVH QSDPNSYPTN STSSLDSVEH EGSTSAFSSV RQDVVHNGIN 120 FQQQPDHMAF SVSSHMVITM QGNGSQQRAP VVR* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
4awl_A | 1e-23 | 17 | 86 | 2 | 74 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters (By similarity). Involved in the blue light (BL) and abscisic acid (ABA) signaling pathways. {ECO:0000250, ECO:0000269|PubMed:17322342}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | PGSC0003DMP400000548 |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | HG975451 | 1e-145 | HG975451.1 Solanum pennellii chromosome ch12, complete genome. | |||
GenBank | HG975524 | 1e-145 | HG975524.1 Solanum lycopersicum chromosome ch12, complete genome. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_015166862.1 | 1e-109 | PREDICTED: nuclear transcription factor Y subunit A-7-like | ||||
Refseq | XP_015166863.1 | 1e-109 | PREDICTED: nuclear transcription factor Y subunit A-7-like | ||||
Refseq | XP_015166864.1 | 1e-109 | PREDICTED: nuclear transcription factor Y subunit A-7-like | ||||
Refseq | XP_015166865.1 | 1e-109 | PREDICTED: nuclear transcription factor Y subunit A-7-like | ||||
Swissprot | Q9SYH4 | 5e-36 | NFYA5_ARATH; Nuclear transcription factor Y subunit A-5 | ||||
TrEMBL | M0ZH82 | 1e-107 | M0ZH82_SOLTU; Uncharacterized protein | ||||
TrEMBL | M0ZH83 | 1e-108 | M0ZH83_SOLTU; Uncharacterized protein | ||||
STRING | Solyc12g009050.1.1 | 1e-105 | (Solanum lycopersicum) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G54160.1 | 2e-38 | nuclear factor Y, subunit A5 |
Link Out ? help Back to Top | |
---|---|
Phytozome | PGSC0003DMP400000548 |
Entrez Gene | 102595015 |