PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

AT1G54160.1

Common Name

F15I1.26, NFYA5, NF-YA5

Organism

Arabidopsis thaliana

Taxonomic ID

3702

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis

Family

NF-YA

Protein Properties

Length: 308aa MW: 33773.7 Da PI: 9.3612

Description

nuclear factor Y, subunit A5

Gene Model

Gene Model ID	Type	Source	Coding Sequence
AT1G54160.1	genome	TAIR	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	CBFB_NFYA	103.6	1.8e-32	177	233	1	58
CBFB_NFYA 1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 +ep++VNaKQy++Il+RR++Rakle+++kl +k+rkpylheSRh hAl+R+RgsgGrF AT1G54160.1 177 NEPIFVNAKQYHAILRRRKHRAKLEAQNKL-IKCRKPYLHESRHLHALKRARGSGGRF 233 59**************************.************************9 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SMART	SM00521	3.3E-36	175	236	IPR001289	Nuclear transcription factor Y subunit A
PROSITE profile	PS51152	36.675	176	236	IPR001289	Nuclear transcription factor Y subunit A
Pfam	PF02045	8.3E-27	178	233	IPR001289	Nuclear transcription factor Y subunit A
PRINTS	PR00616	4.8E-23	179	201	IPR001289	Nuclear transcription factor Y subunit A
PROSITE pattern	PS00686	0	181	201	IPR018362	CCAAT-binding factor, conserved site
PRINTS	PR00616	4.8E-23	210	233	IPR001289	Nuclear transcription factor Y subunit A

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0009414	Biological Process	response to water deprivation
GO:0009738	Biological Process	abscisic acid-activated signaling pathway
GO:0009785	Biological Process	blue light signaling pathway
GO:0010262	Biological Process	somatic embryogenesis
GO:0045892	Biological Process	negative regulation of transcription, DNA-templated
GO:0016602	Cellular Component	CCAAT-binding factor complex
GO:0003677	Molecular Function	DNA binding
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding

Plant Ontology ? help Back to Top
PO Term	PO Category	PO Description
PO:0000036	anatomy	leaf vascular system
PO:0000230	anatomy	inflorescence meristem
PO:0000293	anatomy	guard cell
PO:0003011	anatomy	root vascular system
PO:0009009	anatomy	plant embryo
PO:0009025	anatomy	vascular leaf
PO:0009046	anatomy	flower
PO:0009047	anatomy	stem
PO:0009052	anatomy	flower pedicel
PO:0025022	anatomy	collective leaf structure
PO:0001185	developmental stage	plant embryo globular stage
PO:0004507	developmental stage	plant embryo bilateral stage
PO:0007115	developmental stage	LP.04 four leaves visible stage
PO:0007611	developmental stage	petal differentiation and expansion stage
PO:0007616	developmental stage	flowering stage

Sequence ? help Back to Top
Protein Sequence Length: 308 aa Download sequence Send to blast
MQVFQRKEDS SWGNSMPTTN SNIQGSESFS LTKDMIMSTT QLPAMKHSGL QLQNQDSTSS 60 QSTEEESGGG EVASFGEYKR YGCSIVNNNL SGYIENLGKP IENYTKSITT SSMVSQDSVF 120 PAPTSGQISW SLQCAETSHF NGFLAPEYAS TPTALPHLEM MGLVSSRVPL PHHIQENEPI 180 FVNAKQYHAI LRRRKHRAKL EAQNKLIKCR KPYLHESRHL HALKRARGSG GRFLNTKKLQ 240 ESSNSLCSSQ MANGQNFSMS PHGGGSGIGS SSISPSSNSN CINMFQNPQF RFSGYPSTHH 300 ASALMSGT

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
4awl_A	5e-19	178	238	3	63	NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase

Expression -- UniGene ? help Back to Top
UniGene ID	E-value	Expressed in
At.57160	0.0	silique

Expression -- Microarray ? help Back to Top
Source	ID	E-value
GEO	145336735	0.0
Genevisible	263158_at	0.0
Expression Atlas	AT1G54160	-
AtGenExpress	AT1G54160	-
ATTED-II	AT1G54160	-

Expression -- Description ? help Back to Top
Source	Description
Uniprot	TISSUE SPECIFICITY: Expressed in the whole plant, except roots. Present in etiolated seedlings. {ECO:0000269\|PubMed:11250072, ECO:0000269\|PubMed:17322342}.

Functional Description ? help Back to Top
Source	Description
TAIR	Encodes a member of the CCAAT-binding transcription factor (CBF-B/NF-YA) family. Expression is upregulated in response to ABA and drought. This regulation appears to be mediated by MIR169A which is downregulated in response to drought. NFYA5 is a target of MIR169A. Loss of function mutations are hypersensitive to drought.
UniProt	Stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters (By similarity). Involved in the blue light (BL) and abscisic acid (ABA) signaling pathways. {ECO:0000250, ECO:0000269\|PubMed:17322342}.

Function -- GeneRIF ? help Back to Top
Data show that NFYA5 is important for drought resistance, and its induction by drought stress occurs at both the transcriptional and posttranscriptional levels. [PMID: 18682547] these results provide evidence that NF-YA1, 5, 6, and 9 play redundant roles in male gametophyte development, embryogenesis, seed development, and post-germinative growth. [PMID: 22933713]

Cis-element ? help Back to Top
Source	Link
PlantRegMap	AT1G54160.1

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Phenotype -- Disruption Phenotype ? help Back to Top
Source	Description
UniProt	DISRUPTION PHENOTYPE: Altered response to blue light (BL) and abscisic acid (ABA). {ECO:0000269\|PubMed:17322342}.

Phenotype -- Mutation ? help Back to Top
Source	ID
T-DNA Express	AT1G54160

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AF386957	0.0	AF386957.1 Arabidopsis thaliana Unknown protein (F15I1.26) mRNA, complete cds.
GenBank	AY081445	0.0	AY081445.1 Arabidopsis thaliana unknown protein (At1g54160) mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	NP_175818.1	0.0	nuclear factor Y, subunit A5
Swissprot	Q9SYH4	0.0	NFYA5_ARATH; Nuclear transcription factor Y subunit A-5
TrEMBL	D7KLF3	0.0	D7KLF3_ARALL; Predicted protein
STRING	AT1G54160.1	0.0	(Arabidopsis thaliana)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM11633	17	33
Representative plant	OGRP680	16	72

Link Out ? help Back to Top
Phytozome	AT1G54160.1
Entrez Gene	841856
iHOP	AT1G54160
wikigenes	AT1G54160

Publications ? help Back to Top
Riechmann JL, et al. Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes. Science, 2000. 290(5499): p. 2105-10 [PMID:11118137] Gusmaroli G,Tonelli C,Mantovani R Regulation of the CCAAT-Binding NF-Y subunits in Arabidopsis thaliana. Gene, 2001. 264(2): p. 173-85 [PMID:11250072] Gusmaroli G,Tonelli C,Mantovani R Regulation of novel members of the Arabidopsis thaliana CCAAT-binding nuclear factor Y subunits. Gene, 2002. 283(1-2): p. 41-8 [PMID:11867211] Yamada K, et al. Empirical analysis of transcriptional activity in the Arabidopsis genome. Science, 2003. 302(5646): p. 842-6 [PMID:14593172] Sunkar R,Zhu JK Novel and stress-regulated microRNAs and other small RNAs from Arabidopsis. Plant Cell, 2004. 16(8): p. 2001-19 [PMID:15258262] Lall S,Nettleton D,DeCook R,Che P,Howell SH Quantitative trait loci associated with adventitious shoot formation in tissue culture and the program of shoot development in Arabidopsis. Genetics, 2004. 167(4): p. 1883-92 [PMID:15342526] Ronemus M,Vaughn MW,Martienssen RA MicroRNA-targeted and small interfering RNA-mediated mRNA degradation is regulated by argonaute, dicer, and RNA-dependent RNA polymerase in Arabidopsis. Plant Cell, 2006. 18(7): p. 1559-74 [PMID:16798886] Xin Z,Mandaokar A,Chen J,Last RL,Browse J Arabidopsis ESK1 encodes a novel regulator of freezing tolerance. Plant J., 2007. 49(5): p. 786-99 [PMID:17316173] Warpeha KM, et al. The GCR1, GPA1, PRN1, NF-Y signal chain mediates both blue light and abscisic acid responses in Arabidopsis. Plant Physiol., 2007. 143(4): p. 1590-600 [PMID:17322342] Liu JX,Srivastava R,Che P,Howell SH Salt stress responses in Arabidopsis utilize a signal transduction pathway related to endoplasmic reticulum stress signaling. Plant J., 2007. 51(5): p. 897-909 [PMID:17662035] Li WX, et al. The Arabidopsis NFYA5 transcription factor is regulated transcriptionally and posttranscriptionally to promote drought resistance. Plant Cell, 2008. 20(8): p. 2238-51 [PMID:18682547] Yamamoto A, et al. Arabidopsis NF-YB subunits LEC1 and LEC1-LIKE activate transcription by interacting with seed-specific ABRE-binding factors. Plant J., 2009. 58(5): p. 843-56 [PMID:19207209] Mu J,Tan H,Hong S,Liang Y,Zuo J Arabidopsis transcription factor genes NF-YA1, 5, 6, and 9 play redundant roles in male gametogenesis, embryogenesis, and seed development. Mol Plant, 2013. 6(1): p. 188-201 [PMID:22933713] Leyva-Gonz Functional and transcriptome analysis reveals an acclimatization strategy for abiotic stress tolerance mediated by Arabidopsis NF-YA family members. PLoS ONE, 2012. 7(10): p. e48138 [PMID:23118940] Efroni I, et al. Regulation of leaf maturation by chromatin-mediated modulation of cytokinin responses. Dev. Cell, 2013. 24(4): p. 438-45 [PMID:23449474] Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Gao W,Liu W,Zhao M,Li WX NERF encodes a RING E3 ligase important for drought resistance and enhances the expression of its antisense gene NFYA5 in Arabidopsis. Nucleic Acids Res., 2015. 43(1): p. 607-17 [PMID:25514924] Zhao H, et al. The Arabidopsis thaliana Nuclear Factor Y Transcription Factors. Front Plant Sci, 2016. 7: p. 2045 [PMID:28119722] Nasim Z,Fahim M,Ahn JH Possible Role of MADS AFFECTING FLOWERING 3 and B-BOX DOMAIN PROTEIN 19 in Flowering Time Regulation of Arabidopsis Mutants with Defects in Nonsense-Mediated mRNA Decay. Front Plant Sci, 2017. 8: p. 191 [PMID:28261246] Du Q,Zhao M,Gao W,Sun S,Li WX microRNA/microRNA* complementarity is important for the regulation pattern of NFYA5 by miR169 under dehydration shock in Arabidopsis. Plant J., 2017. 91(1): p. 22-33 [PMID:28332758] Huang KC,Lin WC,Cheng WH Salt hypersensitive mutant 9, a nucleolar APUM23 protein, is essential for salt sensitivity in association with the ABA signaling pathway in Arabidopsis. BMC Plant Biol., 2018. 18(1): p. 40 [PMID:29490615]