Signature Domain? help Back to Top |
|
No. |
Domain |
Score |
E-value |
Start |
End |
HMM Start |
HMM End |
1 | bZIP_1 | 38.1 | 3.3e-12 | 130 | 174 | 11 | 56 |
HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
bZIP_1 11 qkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkev 56
++ Re+ArrsR+RK+a + Le v+ L++eN +L + l+ +++
SapurV1A.0263s0230.1.p 130 IR-RESARRSRKRKQAHLSDLEVQVDHLTGENASLFNHLSDAAQQY 174
55.9*****************************9995555554444 PP
|
Annotation --
Nucleotide ? help
Back to Top |
Source |
Hit ID |
E-value |
Description |
GenBank | GU275060 | 6e-38 | GU275060.1 Populus balsamifera isolate GIL14 haplotype A G/HBF1-related bZIP protein gene, partial sequence. |
GenBank | GU275061 | 6e-38 | GU275061.1 Populus balsamifera isolate GIL14 haplotype B G/HBF1-related bZIP protein gene, partial sequence. |
GenBank | GU275062 | 6e-38 | GU275062.1 Populus balsamifera isolate HAY07 haplotype A G/HBF1-related bZIP protein gene, partial sequence. |
GenBank | GU275063 | 6e-38 | GU275063.1 Populus balsamifera isolate HAY07 haplotype B G/HBF1-related bZIP protein gene, partial sequence. |
GenBank | GU275064 | 6e-38 | GU275064.1 Populus balsamifera isolate INU03 haplotype A G/HBF1-related bZIP protein gene, partial sequence. |
GenBank | GU275065 | 6e-38 | GU275065.1 Populus balsamifera isolate INU03 haplotype B G/HBF1-related bZIP protein gene, partial sequence. |
GenBank | GU275066 | 6e-38 | GU275066.1 Populus balsamifera isolate KUU07 haplotype A G/HBF1-related bZIP protein gene, partial sequence. |
GenBank | GU275067 | 6e-38 | GU275067.1 Populus balsamifera isolate KUU07 haplotype B G/HBF1-related bZIP protein gene, partial sequence. |
GenBank | GU275068 | 6e-38 | GU275068.1 Populus balsamifera isolate LOV02 haplotype A G/HBF1-related bZIP protein gene, partial sequence. |
GenBank | GU275069 | 6e-38 | GU275069.1 Populus balsamifera isolate LOV02 haplotype B G/HBF1-related bZIP protein gene, partial sequence. |
GenBank | GU275070 | 6e-38 | GU275070.1 Populus balsamifera isolate MGR10 haplotype A G/HBF1-related bZIP protein gene, partial sequence. |
GenBank | GU275071 | 6e-38 | GU275071.1 Populus balsamifera isolate MGR10 haplotype B G/HBF1-related bZIP protein gene, partial sequence. |
GenBank | GU275072 | 6e-38 | GU275072.1 Populus balsamifera isolate NWL07 haplotype A G/HBF1-related bZIP protein gene, partial sequence. |
GenBank | GU275073 | 6e-38 | GU275073.1 Populus balsamifera isolate NWL07 haplotype B G/HBF1-related bZIP protein gene, partial sequence. |
GenBank | GU275074 | 6e-38 | GU275074.1 Populus balsamifera isolate POR11 haplotype A G/HBF1-related bZIP protein gene, partial sequence. |
GenBank | GU275075 | 6e-38 | GU275075.1 Populus balsamifera isolate POR11 haplotype B G/HBF1-related bZIP protein gene, partial sequence. |
GenBank | GU275076 | 6e-38 | GU275076.1 Populus balsamifera isolate RNA13 haplotype A G/HBF1-related bZIP protein gene, partial sequence. |
GenBank | GU275077 | 6e-38 | GU275077.1 Populus balsamifera isolate RNA13 haplotype B G/HBF1-related bZIP protein gene, partial sequence. |
GenBank | GU275078 | 6e-38 | GU275078.1 Populus balsamifera isolate WHR03 haplotype A G/HBF1-related bZIP protein gene, partial sequence. |
GenBank | GU275079 | 6e-38 | GU275079.1 Populus balsamifera isolate WHR03 haplotype B G/HBF1-related bZIP protein gene, partial sequence. |