PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | SapurV1A.0045s0580.1.p | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 217aa MW: 25021 Da PI: 10.4243 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 95.6 | 2.1e-30 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 krien + rqvtfskRrng+lKKA+ELSvLCdaeva+i+fs++gklye+ss SapurV1A.0045s0580.1.p 9 KRIENATSRQVTFSKRRNGLLKKAFELSVLCDAEVALIVFSTRGKLYEFSS 59 79***********************************************96 PP | |||||||
2 | K-box | 74.9 | 2.2e-25 | 85 | 171 | 12 | 98 |
K-box 12 akaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkl 98 + + +++ L k+ie L+ ++R+l+G +Le++s+ eL+qLe+qLe+sl++iRs+Kn+ll+eqi++l+ ek l een++Lr+k+ SapurV1A.0045s0580.1.p 85 DNIQPVKEDPFTLAKKIEDLEVSKRKLVGVGLEPCSIDELKQLENQLERSLTRIRSRKNQLLREQIQKLKGEEKILLEENTRLREKV 171 5567777788899************************************************************************98 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50066 | 32.352 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
SMART | SM00432 | 1.9E-40 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 3.96E-42 | 2 | 71 | No hit | No description |
SuperFamily | SSF55455 | 3.27E-32 | 3 | 72 | IPR002100 | Transcription factor, MADS-box |
PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 3.3E-31 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 3.2E-26 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 3.3E-31 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 3.3E-31 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF01486 | 5.4E-25 | 85 | 171 | IPR002487 | Transcription factor, K-box |
PROSITE profile | PS51297 | 14.575 | 87 | 177 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0010048 | Biological Process | vernalization response | ||||
GO:0048510 | Biological Process | regulation of timing of transition from vegetative to reproductive phase | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 217 aa Download sequence Send to blast |
MARGKTQMKR IENATSRQVT FSKRRNGLLK KAFELSVLCD AEVALIVFST RGKLYEFSSS 60 SINRTIERYQ KRARDVGISS KMVQDNIQPV KEDPFTLAKK IEDLEVSKRK LVGVGLEPCS 120 IDELKQLENQ LERSLTRIRS RKNQLLREQI QKLKGEEKIL LEENTRLREK VVQCGMQPHE 180 LSSTKKNPQQ LEDRRVMEVE TELFIGPPET RLPQKP* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1tqe_R | 4e-19 | 1 | 69 | 1 | 69 | Myocyte-specific enhancer factor 2B |
1tqe_S | 4e-19 | 1 | 69 | 1 | 69 | Myocyte-specific enhancer factor 2B |
5f28_A | 4e-19 | 1 | 69 | 1 | 69 | MEF2C |
5f28_B | 4e-19 | 1 | 69 | 1 | 69 | MEF2C |
5f28_C | 4e-19 | 1 | 69 | 1 | 69 | MEF2C |
5f28_D | 4e-19 | 1 | 69 | 1 | 69 | MEF2C |
6byy_A | 4e-19 | 1 | 69 | 1 | 69 | MEF2 CHIMERA |
6byy_B | 4e-19 | 1 | 69 | 1 | 69 | MEF2 CHIMERA |
6byy_C | 4e-19 | 1 | 69 | 1 | 69 | MEF2 CHIMERA |
6byy_D | 4e-19 | 1 | 69 | 1 | 69 | MEF2 CHIMERA |
6bz1_A | 4e-19 | 1 | 69 | 1 | 69 | MEF2 CHIMERA |
6bz1_B | 4e-19 | 1 | 69 | 1 | 69 | MEF2 CHIMERA |
6bz1_C | 4e-19 | 1 | 69 | 1 | 69 | MEF2 CHIMERA |
6bz1_D | 4e-19 | 1 | 69 | 1 | 69 | MEF2 CHIMERA |
6c9l_A | 4e-19 | 1 | 69 | 1 | 69 | Myocyte-specific enhancer factor 2B |
6c9l_B | 4e-19 | 1 | 69 | 1 | 69 | Myocyte-specific enhancer factor 2B |
6c9l_C | 4e-19 | 1 | 69 | 1 | 69 | Myocyte-specific enhancer factor 2B |
6c9l_D | 4e-19 | 1 | 69 | 1 | 69 | Myocyte-specific enhancer factor 2B |
6c9l_E | 4e-19 | 1 | 69 | 1 | 69 | Myocyte-specific enhancer factor 2B |
6c9l_F | 4e-19 | 1 | 69 | 1 | 69 | Myocyte-specific enhancer factor 2B |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor that promotes flowering, especially in response to vernalization by short periods of cold, in an FLC-inpedendent manner. {ECO:0000269|PubMed:16778081}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | SapurV1A.0045s0580.1.p |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Maintained at very low levels by the polycomb-group (PcG) proteins MSI1, CLF, and EMF2 via histone methylation (H3K27me3). Derepressed upon cold treatment (vernalization). {ECO:0000269|PubMed:16778081}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | CU224793 | 0.0 | CU224793.1 Populus EST from leave. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_024452474.1 | 1e-124 | agamous-like MADS-box protein AGL19 isoform X1 | ||||
Refseq | XP_024452475.1 | 1e-124 | agamous-like MADS-box protein AGL19 isoform X1 | ||||
Swissprot | O82743 | 3e-84 | AGL19_ARATH; Agamous-like MADS-box protein AGL19 | ||||
TrEMBL | B9GW46 | 1e-123 | B9GW46_POPTR; Uncharacterized protein | ||||
STRING | EOY24583 | 9e-97 | (Theobroma cacao) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF666 | 30 | 102 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G22950.1 | 1e-80 | AGAMOUS-like 19 |
Link Out ? help Back to Top | |
---|---|
Phytozome | SapurV1A.0045s0580.1.p |
Publications ? help Back to Top | |||
---|---|---|---|
|