PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

AT4G22950.1

Common Name

AGL19, F7H19.130, GL19

Organism

Arabidopsis thaliana

Taxonomic ID

3702

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis

Family

MIKC_MADS

Protein Properties

Length: 219aa MW: 25048.5 Da PI: 9.9624

Description

AGAMOUS-like 19

Gene Model

Gene Model ID	Type	Source	Coding Sequence
AT4G22950.1	genome	TAIR	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SRF-TF	92.3	2.3e-29	9	59	1	51
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 krien + rqvtfskRrng+lKKA+ELSvLCdaeva++ifs++ klye+ss AT4G22950.1 9 KRIENATSRQVTFSKRRNGLLKKAFELSVLCDAEVALVIFSPRSKLYEFSS 59 79***********************************************96 PP
2	K-box	79.4	8.8e-27	79	170	7	98
K-box 7 ksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkl 98 +++ + ++++ + e + L k+ie+L+ ++R+llGe+++ +s++eLqqLe+qL++sl++iR+kK++ll+e+ie+l+ e++l +enk+L++k+ AT4G22950.1 79 NHKRNDNSQQARDETSGLTKKIEQLEISKRKLLGEGIDACSIEELQQLENQLDRSLSRIRAKKYQLLREEIEKLKAEERNLVKENKDLKEKW 170 4467788999*******************************************************************************996 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SMART	SM00432	3.5E-39	1	60	IPR002100	Transcription factor, MADS-box
PROSITE profile	PS50066	31.286	1	61	IPR002100	Transcription factor, MADS-box
CDD	cd00265	1.85E-39	3	70	No hit	No description
PRINTS	PR00404	4.4E-30	3	23	IPR002100	Transcription factor, MADS-box
SuperFamily	SSF55455	1.44E-31	3	74	IPR002100	Transcription factor, MADS-box
PROSITE pattern	PS00350	0	3	57	IPR002100	Transcription factor, MADS-box
Pfam	PF00319	4.8E-26	10	57	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	4.4E-30	23	38	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	4.4E-30	38	59	IPR002100	Transcription factor, MADS-box
Pfam	PF01486	3.7E-26	83	169	IPR002487	Transcription factor, K-box
PROSITE profile	PS51297	14.845	86	176	IPR002487	Transcription factor, K-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0009908	Biological Process	flower development
GO:0010048	Biological Process	vernalization response
GO:0048510	Biological Process	regulation of timing of transition from vegetative to reproductive phase
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0005515	Molecular Function	protein binding
GO:0046983	Molecular Function	protein dimerization activity

Plant Ontology ? help Back to Top
PO Term	PO Category	PO Description
PO:0000013	anatomy	cauline leaf
PO:0000014	anatomy	rosette leaf
PO:0000037	anatomy	shoot apex
PO:0000293	anatomy	guard cell
PO:0006036	anatomy	root epidermis
PO:0008019	anatomy	leaf lamina base
PO:0009005	anatomy	root
PO:0009025	anatomy	vascular leaf
PO:0009046	anatomy	flower
PO:0009047	anatomy	stem
PO:0020038	anatomy	petiole
PO:0020131	anatomy	lateral root cap
PO:0025022	anatomy	collective leaf structure
PO:0007115	developmental stage	LP.04 four leaves visible stage
PO:0007131	developmental stage	seedling development stage

Sequence ? help Back to Top
Protein Sequence Length: 219 aa Download sequence Send to blast
MVRGKTEMKR IENATSRQVT FSKRRNGLLK KAFELSVLCD AEVALVIFSP RSKLYEFSSS 60 SIAATIERYQ RRIKEIGNNH KRNDNSQQAR DETSGLTKKI EQLEISKRKL LGEGIDACSI 120 EELQQLENQL DRSLSRIRAK KYQLLREEIE KLKAEERNLV KENKDLKEKW LGMGTATIAS 180 SQSTLSSSEV NIDDNMEVET GLFIGPPETR QSKKFPPQN

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
5f28_A	2e-17	1	69	1	69	MEF2C
5f28_B	2e-17	1	69	1	69	MEF2C
5f28_C	2e-17	1	69	1	69	MEF2C
5f28_D	2e-17	1	69	1	69	MEF2C
Search in ModeBase

Expression -- Microarray ? help Back to Top
Source	ID	E-value
Genevisible	254286_at	0.0
Expression Atlas	AT4G22950	-
AtGenExpress	AT4G22950	-
ATTED-II	AT4G22950	-

Expression -- Description ? help Back to Top
Source	Description
Uniprot	TISSUE SPECIFICITY: Mostly expressed in the outer layers of the root meristem (lateral root cap and epidermis) and in the central cylinder cells of mature roots. Also present in rosette leaves and seedlings and, to a lesser extent, in cauline leaves and flowers. Enriched in apices including the shoot apical meristem and developing leaf primordia. {ECO:0000269\|PubMed:11115127, ECO:0000269\|PubMed:12837945, ECO:0000269\|PubMed:12949148, ECO:0000269\|PubMed:16778081}.

Functional Description ? help Back to Top
Source	Description
TAIR	MADS-box protein AGL19
UniProt	Probable transcription factor that promotes flowering, especially in response to vernalization by short periods of cold, in an FLC-inpedendent manner. {ECO:0000269\|PubMed:16778081}.

Function -- GeneRIF ? help Back to Top
AGL19 expression is maintained at very low levels by the PcG proteins MSI1, CLF, and EMF2, and AGL19 is partly responsible for the early flowering phenotype of clf mutants. [PMID: 16778081] The data indicate thatHDA9 represses flowering by repressing AGL19 gene expressionindependently of CONSTANS or FLC pathways. [PMID: 23237803] HDA9 prevents precocious flowering under SD conditions by curbing the hyperactivation of AGL19, an upstream activator of FT, through resetting the local chromatin environment. [PMID: 25406502]

Cis-element ? help Back to Top
Source	Link
PlantRegMap	AT4G22950.1

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Maintained at very low levels by the polycomb-group (PcG) proteins MSI1, CLF, and EMF2 via histone methylation (H3K27me3). Derepressed upon cold treatment (vernalization). {ECO:0000269\|PubMed:16778081}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Interaction ? help Back to Top
Source	Intact With
BioGRID	AT4G37940
IntAct	Search O82743

Phenotype -- Disruption Phenotype ? help Back to Top
Source	Description
UniProt	DISRUPTION PHENOTYPE: Decreased response to vernalization, the promotion of flowering by prolonged cold. {ECO:0000269\|PubMed:16778081}.

Phenotype -- Mutation ? help Back to Top
Source	ID
T-DNA Express	AT4G22950

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AF312664	0.0	AF312664.1 Arabidopsis thaliana MADS-box protein AGL19 (AGL19) mRNA, complete cds.
GenBank	AY142523	0.0	AY142523.1 Arabidopsis thaliana putative MADS box AGL protein (At4g22950) mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	NP_001320037.1	1e-158	AGAMOUS-like 19
Refseq	NP_194026.1	1e-158	AGAMOUS-like 19
Swissprot	O82743	1e-160	AGL19_ARATH; Agamous-like MADS-box protein AGL19
TrEMBL	A0A178V3F3	1e-157	A0A178V3F3_ARATH; GL19
STRING	AT4G22950.1	1e-158	(Arabidopsis thaliana)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM78	28	413
Representative plant	OGRP16	17	761

Link Out ? help Back to Top
Phytozome	AT4G22950.1
Entrez Gene	828394
iHOP	AT4G22950
wikigenes	AT4G22950

Publications ? help Back to Top
Alvarez-Buylla ER, et al. MADS-box gene evolution beyond flowers: expression in pollen, endosperm, guard cells, roots and trichomes. Plant J., 2000. 24(4): p. 457-66 [PMID:11115127] Riechmann JL, et al. Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes. Science, 2000. 290(5499): p. 2105-10 [PMID:11118137] Parenicová L, et al. Molecular and phylogenetic analyses of the complete MADS-box transcription factor family in Arabidopsis: new openings to the MADS world. Plant Cell, 2003. 15(7): p. 1538-51 [PMID:12837945] Kofuji R, et al. Evolution and divergence of the MADS-box gene family based on genome-wide expression analyses. Mol. Biol. Evol., 2003. 20(12): p. 1963-77 [PMID:12949148] Yamada K, et al. Empirical analysis of transcriptional activity in the Arabidopsis genome. Science, 2003. 302(5646): p. 842-6 [PMID:14593172] Czechowski T,Bari RP,Stitt M,Scheible WR,Udvardi MK Real-time RT-PCR profiling of over 1400 Arabidopsis transcription factors: unprecedented sensitivity reveals novel root- and shoot-specific genes. Plant J., 2004. 38(2): p. 366-79 [PMID:15078338] De Paepe A,Vuylsteke M,Van Hummelen P,Zabeau M,Van Der Straeten D Transcriptional profiling by cDNA-AFLP and microarray analysis reveals novel insights into the early response to ethylene in Arabidopsis. Plant J., 2004. 39(4): p. 537-59 [PMID:15272873] de Folter S, et al. Comprehensive interaction map of the Arabidopsis MADS Box transcription factors. Plant Cell, 2005. 17(5): p. 1424-33 [PMID:15805477] Pina C,Pinto F,Feij Gene family analysis of the Arabidopsis pollen transcriptome reveals biological implications for cell growth, division control, and gene expression regulation. Plant Physiol., 2005. 138(2): p. 744-56 [PMID:15908605] Gan Y,Filleur S,Rahman A,Gotensparre S,Forde BG Nutritional regulation of ANR1 and other root-expressed MADS-box genes in Arabidopsis thaliana. Planta, 2005. 222(4): p. 730-42 [PMID:16021502] Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] Schönrock N, et al. Polycomb-group proteins repress the floral activator AGL19 in the FLC-independent vernalization pathway. Genes Dev., 2006. 20(12): p. 1667-78 [PMID:16778081] Pien S, et al. ARABIDOPSIS TRITHORAX1 dynamically regulates FLOWERING LOCUS C activation via histone 3 lysine 4 trimethylation. Plant Cell, 2008. 20(3): p. 580-8 [PMID:18375656] Alexandre CM,Hennig L FLC or not FLC: the other side of vernalization. J. Exp. Bot., 2008. 59(6): p. 1127-35 [PMID:18390846] Liang S, et al. Transcriptional Regulations on the Low-Temperature-Induced Floral Transition in an Orchidaceae Species, Dendrobium nobile: An Expressed Sequence Tags Analysis. Comp. Funct. Genomics, 2012. 2012: p. 757801 [PMID:22550428] Kim W,Latrasse D,Servet C,Zhou DX Arabidopsis histone deacetylase HDA9 regulates flowering time through repression of AGL19. Biochem. Biophys. Res. Commun., 2013. 432(2): p. 394-8 [PMID:23237803] Suter L,Rüegg M,Zemp N,Hennig L,Widmer A Gene regulatory variation mediates flowering responses to vernalization along an altitudinal gradient in Arabidopsis. Plant Physiol., 2014. 166(4): p. 1928-42 [PMID:25339407] Kang MJ,Jin HS,Noh YS,Noh B Repression of flowering under a noninductive photoperiod by the HDA9-AGL19-FT module in Arabidopsis. New Phytol., 2015. 206(1): p. 281-94 [PMID:25406502]