PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Spipo9G0016600
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Araceae; Lemnoideae; Spirodela
Family TCP
Protein Properties Length: 189aa    MW: 20701.5 Da    PI: 7.674
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Spipo9G0016600genomeMIPS/IBISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP87.14e-2742109370
             TCP   3 gkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssa 70 
                     g+kdrhsk+ T +g+RdRRvRls+++a +++dLq++LG+ ++sk ++WLl +a ++i++l+ +++++ 
  Spipo9G0016600  42 GGKDRHSKVTTVRGLRDRRVRLSVPTAVQLYDLQERLGLSQPSKVVDWLLDAARHEIDKLPPLPFPPG 109
                     78***********************************************************9966654 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5136927.90743101IPR017887Transcription factor TCP subgroup
PfamPF036343.0E-2543103IPR005333Transcription factor, TCP
Sequence ? help Back to Top
Protein Sequence    Length: 189 aa     Download sequence    Send to blast
MTRDPYEDGR KAEKLTGATP SLRGWAAELG DPRIVRVSRS LGGKDRHSKV TTVRGLRDRR  60
VRLSVPTAVQ LYDLQERLGL SQPSKVVDWL LDAARHEIDK LPPLPFPPGG FFPICPPPPT  120
TAPWHPAESS DLRDPRLGFC QVVEGEELHG FRPPPPMSSS YVGAAAQINN FLMGVSEEHL  180
QSSALHGE*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5zkt_A2e-1848102155Putative transcription factor PCF6
5zkt_B2e-1848102155Putative transcription factor PCF6
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009406310.11e-45PREDICTED: transcription factor TCP5-like
RefseqXP_018682833.11e-45PREDICTED: transcription factor TCP5-like
RefseqXP_018682834.11e-45PREDICTED: transcription factor TCP5-like
RefseqXP_018682835.11e-45PREDICTED: transcription factor TCP5-like
RefseqXP_018682836.11e-45PREDICTED: transcription factor TCP5-like
RefseqXP_018682837.11e-45PREDICTED: transcription factor TCP5-like
TrEMBLA0A1D1YQI41e-46A0A1D1YQI4_9ARAE; Transcription factor TCP5 (Fragment)
STRINGGSMUA_Achr6P27420_0014e-45(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP24903584
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60970.13e-38TEOSINTE BRANCHED 1, cycloidea and PCF transcription factor 5